Protection of Plant Vhrieties and Farmers’ Rights Rules, 2003.
Text
(l) fgwammmmw fighmiqmemmamgggzawgwhzumw'z sewn (mmmfi) umoumvma'msrmnd W3W (a) “m’fimwwmafifiat WWE‘; I (a) “W’fim1zafim'(4)$mfi=rfigwmfim memm; (a) “‘W”%wwamwm%{ (a) “m”fiwafiflmafiafifimmfia%; (a) wmvfifiafiufiflfifisfimfisfiisfifiWfi (2) fimmmmmwfiwmmfi I L M T EEEEEEFMEEE Egfiggfigwfifimgfigg EEEEEEMEEEMEE figfififififiwfifiafiwgfifig EEEEEBEEEEHWE E (2) wfiuwhfifiwfimfiflfigafimwwmwfia fimma mamarfifiuw$mfifiafimlfiafifi$fifi ugarffifiwmfifimmsfifimfiwmmafimfi mfimwmmmfimflfimfimm Wfimfiwmfifififlmfififimfiam (2) mmfimwafifimmtmmmg Mlfizmmma‘t filmmakmmafimmmfimfimafii mama'fiml afimzfimmfiqgamml (2) mmmmfimmfifimfimm WWW: . ?anldflxfi 53335"as @414 £34 .3. «£3 $43.33 53%.: a 334 mg ifignganfiagaefifixfigfi E %%fi gsgxflaflaififififififlflfia figwfiufiflsflgaflafiugfifiafigfi .33333. n. g... gfiiyfiafifidflmflmflfiwflafifidga gsflasfifiyfififisggfifiafigi afisaayfisfiniaefigflfifiafiiaafi imamflgflflflflfififigfifisasnaafl Qflimigswfimgfinmmfisqzfl flgafiifigfiafiflwwififlag WWW! mfifiufifikafifififinfimfifirfififiawmfifiafiafimm EITHI (E) Whammfimamwmmm WWWI Wmfimflafifimml swam- (mymmmammfimaawmmmfimmm WWW! l Iammaamgmwwwaemw _lg- Immamwmyuflwmfimmm mmmamfihmwaflammw m2 I (1) mafifigmmwmmammmm \ {35)fififi,?fif3fi?fiififirfimfim,fififim- arm mmmmmfimmfiwmaammfigfmam wmfimfimml _ Wwflfimmmwafil 12.31221633113me- mfimagfirwfifimfimmfifimmmfifimrw _%%%E%§yg§5 gwggwfiifififlfiggmfimfifi fifiwfifiwfififimagflggwfiige .mfigatgfiwfi u4 Efigwfigwfiwwgafigfiafififiis 10 THE GAZETTE OF INDIA '. EXTRAORDINARY [PmTE—Sn 36)] 16. NW 3% W:- (fimafifimfimamwwmfiwfinwmgm Efififiawmmwfifimafifimifiml (wmflmfififlweflvwfiufimafifimmammg Wflfifiafiwfiml mmmafimammamafimfiaflvamfimfififiw Wawamafimmmmmmwamml (swifafimafififiwuaufimafivnfifimwwfiafigqafifimm m WWWWWWWWWI (mmmmmaflfifinafiml fi fia awafimfifimfimmmafimfimal W fi Wfiwafifirfimfififiwmfihmmfiwfiafi mfimmfimmmfimfimmafifi fifiafianl meWfi, Wmfimmafifimww WWW! (wmmawwmaml mfiwmafimml. (fimfifififififimmmafiafifigafimafimfifiw Wfimfififil ‘ Wfifigfimml Wzfifimfimwfiififiml nfifimfimfimfifimmmfifiafifigfiafififi: qfimfifiagwfififififieafiafihfifiufifinfisflvfigfifim WWI mmmzfimifiefimfiafimmmmafimwmm WWI ammgqufifiafimfifimafitfirfifisfififiafifiafinfifigfifiafi mafimmafifm- Wfimmnfiwfimafimmfifisfiafi mmfimmfiwmmmwmafiww mafimmmqmfimfifiwmmmmww “Wwfimmfimmmmafimfifia WWI Wfifimafiwfifimmwml awafifiqmfimfinfifimfimfiafimfifiqm firm Wwfimqum- wmmafififififififififimwafimzfi WWWWWWI Wawfirwafivmqfiwmmmmw mmmmmfiwfifiafimfifiwafi amfiwammmmfigm WWI Ummmflfimwfiwwzfimfiw Wifiwamflwfiafivfiwmml WWI mafiwmfififiwfimfimafimfifififimafiifim WWWWWWWWWI Mu. E gag"; G fiaafidwmflzwa. . gifidfldafiflamggflflflfiflfl. ggfiggmflfififlmflafiflfinflg E fififlfivfiafiuflw flaggmfiammflflwagfiw agflifiafiflflflvfiafiw wad“ Eflflfiefimflfiaflfimfifldflggwflflafl Eflflmwnaawmflw gigaiggw gfigfifimfifl" afidfiflwiaflw eamflfivfluimflaaw _f A fi w A thus. manmaewmmmmwmmwwmma fmealwwmm Whammsawsawlww imam £03m (V6) (v3) Haulage“ saga"; . A. 5 8805.8le Gav §.fl§flfls$fi.§m$mflfiaflififln as mafia $ufiiaflfimsmflgw. 14%.“ E. ‘ . §S§§%fi%%. . . _ , a ‘mfigimflfiamwflflflmfiflgwfia. GEE”! E . Ag a a a E E .efidfiwafifl galafiid aflafifiaflaggw aflflmfifimflmfla giannaidl gfigfiid flaunwmmmnuawmmmwflm welmm-aantmwwaamwgunwm Imam Mahimanwwwmwpummm wwmemmeyww mmem "Pl [mnewgm mmmzm fifi-zfifififififififimmmmfiw za. mwfimfiwqfimmafim- Wakmmmflfiakmafiwfififieammm ml 29. mnfimfifiwfimmfififiqfifimw ' gmafiwmfiam’w: (E) Wfimmmmwfimmmawm fimfiamfimwtl mmmmmmfil , fifiw (afimmmmmémmfififia m: ‘mmmammmu (4) Wfimmmfizgwfiwafimfiafififimfi ('5) mmfiqfiwfimfiahfimafiiffimmfim wmfiwgmfififimafiml .55555555555555555555E 555555555555555555555555V .5555555555555555555555E .55555555555555555535555555Q F5.555555555555555555555555555555 5%555555555555555555555555a; 5555555555555555.5555555E .on (‘5‘) wawgfimmmmu flm W a’s mmflfrus 5 #1555551“! m5 (4) afié mile? 515525 55555555555555555 fiw mm WI ‘ - V - 5559155595151 mammafimfiwafimahfim 3113mm 3 mmfi Wfimmmmufimmwfim Wmfififiaafimfifiasml (mafififiafigwwwmaa’rmmmmfiaw (1T) fifiefiefimfifiafiwfimmfifitfimafimm Wwwfifimfimaflvwafiifimmmfimv WWI _ wwwmfifiafifimfisofififififimfiwfiafiwnfijfianfia WWI mmmmmfi "5551 . (Smafiafilfifiaifiifififififififiwfifiaflvfifimmmmfi 3135113 mg? fimml (QWWWHfiW-m Mafiamwwfifimmm 55555555555555555555555535 35m 5555555555555553555555555 ETHTI Q WNW :- fifiqarsfia? 555555555ng55 ~555~.5E5555555555555555555 E-5555 _E5av£55555_€5 5555555555555555555533255558E5E5555®5 -555555555555555555855.mm 55251555555515, 555575, Wfimmfiwafifi (3W (1)$me (1} 5m 5555535555qu 5524-6525150555 (mafianfiwwfifififimfifimmfimmmafi afivufimfifififimwfififiafivmfimmfiwfim 25m: 40. mzsfimmmfimmmmgmfiafi Mmm- fl n :5 > m Wamfiwmwt (unfimmfiwrfitfimafivmm; (mgmamfimfiimmafitfimfi; (3)31fi3lalfifiTfi3fiYW, Wafiwfiafivmmmfimfi fimfimmwwgmfifimfi; arm mmafimfimnmafiamfiahfimmmm: 55555553 ..._EEB5£5 55555E .1..g...._5.555555555555 .§5E55555W5555555555555555555553 5555555555555555£55555555EE55553 (5,)mthasm wmfiwmfiflmfifiwfiw WWW! “51955555555111 fifimmffimammamwakmmm 5555,5555.m265m(5)555(5)5555(5)5535555 WWW“ . , WWW1155535? 55555555515555: Wfiwmfimwmmfix ' ' “.mzsifiatfifimmafiaqafififitwfififim- WWL , _ _ W$Wfiémmaflfi$mfifi9 fiffimml SET“? figfifiaggfifiggsfig IE Efigmafisfiggfiwgfimgsggfi W$ WWWWI m1 _- ’ mzaahiefififiwfimwfifiamwfiafimmmmm WI Wammmfimaflfifiafifi WWI 'atsm- 5 . Wm EEEFEEEEEVEEEEE ZEE é EEEEAEEEAEEEEME EEEFEWEELEEEEBEEBEE :fisfi wucwgfiwnfiflmfiwrfifimwfiggfimfigg ga figgaggmegfigggmfifigfigsg E Eaggfifimgggfimggga _£EB§&B VMEEAZEEQEEEEAEMWEEN .Efififisfififiggfiwgwfiwfiafig EKMEEEBEEEEMEEEFE :fi Wfiwfiwfifafiififiaml mmfimammfixmfimafiwmm mmafimfifiwflmml , ‘ WWWWWI 53. film szisaifiwufimarmmfisfiiqfimé (23m) wmfififitfigiwmfififiwwfimfimmfifimmt Wifififififiufififilflwfifiwmfimfiflfimmwfimwas mfifipwfififiwmvfifiqhmmmmfififimmwmm afiafian anwfiafiamfimmwfiwwwammmamfimmfi mmmm Wwafimafimaafiwfim’ ?memmafiwmafiififiwfimwfi mm W' (a) WWWafimfiwwfimewfiwm WM fimfimmfim: MGM _EEE k..2TB," Efigfigggfigfiwwfigwfig ”Egagfififipwfifiwfififififififig Egfifisgfififiasfififigg .Efiuwrflfigwwwfiwfi ..Efifiggwfiwfiwfifiufifisfisfigfi .EEE waginvawwfifiafifimgfififigwfifipfig m}; GAZETTE OF INDIA :wgwmmv _ , [pmu—msm] mumafifimafififia m: mfimmmmflfififimmwmmfimmwhfifimn maefimmmvfiwwfimfimafiwflafiam mam} WW$mafiafiwwafivmmme afizfiqfimwmmfififimmfiwmmafivafiwm afiffifimfiqfifimi \ u; mamwWem as man mafia?! (awmnammaawmmamwmfiwrfifim fifi-mfifimmml mwgofiaeflwmfigmmammafiufim- Ed'qi'mmflmmfiwfifim whimmumfirth: WWI WMmW'm'm-w afim (2) $312113 Wfimmfimafiimgfinfiiafiwmafimmfi Wezwmmfiwmfimmfifiafim- -Wmfi; GHWTTI (2) Wwwmmfiiwmfififififimflfififij wwwifiarfifimamafimfififimfifififimfiafi Wfimfifififiml (a) WWW‘mfiafiafiwmmfihMWflwmfi Ema; afimfil (2) mmmmfimmufiaawmfimmmmfima mfifigfiwfimwml mmqafimmmfmmmfimwmfifinfiaififlffim afi-nfifiafiafimwwl m -. VI? " samsafigfifimfimm- _ (1) afimm, memmmwlmasafima)$ zsfimmmmmm, ,. _ WfifiWW135WWEfi$fififi§Wfifi§$fiWfiv :a fimwfifimmmi aflvmdasqm’r um}mWfim smufimfiammfim ' Wifiwfimmmfivmmmfinfimmwfiw wmfimamfim'mammmmm :5B Efifigfififififiwggfiefigfig fiavgwmfimmpfifiwpwfigfiflmmwgfigfigfa ggfifiafigfififiwfiafiwggfif; Eafifififiwfigwfiafigmfiwfiwfiggm wfiwfifwfiygwfifizfipgwgggwfifi _EVB Egfimfiafigawfigrfiggrfiw 45%ch .EEEEEEE ,EEEMMEEEEEESEEE =>E55 ,”Emwrwgfifigmwwwfifiwwg. Ekszwmfifiwwgfiwmflwwfiwmgfiuwfism S (iofau-mamaafi'mwmizmmm, 341—313?me Wfimfimmmmfimmm Wfifiqfimmfimfiafimfiwmzfiifimmfiw mihffifiuefisnmmm'afififigamfiififimmw mmfifmml _ mlmfimfifiamfiamaflafifiafimmfiafiwmmaafi mmmmmmmmmmmmfiafifim Was magma mam wwmmfimmm amml wfigsgfififigsggrfimwfiafia 7g? .FE EEEEEEEEEEEE ESE figfifiwfiwwfigsgsggwwwsfigfi (8)~(3)(L) (memw ufitfimuaah mew wmw mmma W-EMD mwmfilfi saflhmwmmm mahwswsemwmse mm seawmymmwamww ngmmcamuemnm m WEMQM sewsewmsbmmemm starlmmumaunammw Mitww mmamlm ostrugzuamzsmn armwmgzw ZZWLPI 081:th 8L1¢P¥h 1:me 17me um sum aunt: ALHP 9:me sump, vans: sump ._‘"W-' (‘6).{F} gg;’4109.-/005l mm‘8 11:11]}wa'8 Wwfi (tr)(8) (a)(l) ugh (mam) WM 392191105wa ham mmmmmwewmm Maemmwnsawtmm tame wwwsemm 2am 'wmaw {ngme (e) (3)(L) 9t? mm$ pm I m 000/.'W' ooog-sammhzeuehl-gg‘ 'mmatmm 0000L*W 48 me GAZETTE OF INDIA : ExmokpmARY 19m11—31:;1a)] WNW“ {W20(1)31§} fio‘fi'c qaanm qa’iafifio him am ‘ 01631031113111! U) (2) (3) (4) (5) (5) 18.300 mmafitmfim ' - Mmmfiwfimr .' mmfim 1 ~ 15.200 ammaflmm Mmmfil Mmmfiwfium fiafimfififimafiwl 4. 25112131021710 1 WW 8.000- fimfifimmfimfi Mmmfi’afiafiu fifiafiwwwfiwfi mfiafimmamfi MI Wmmefiaafi mfimtfiafim’rfirfifi 6. WW 5 5.500 mefiafiam 9.000 fiwmfim’ mmaamfima mwfimafifial <T§§o§~ ..............8m5:: _5E5555555555 mmksfiawmgfigvmfifiggfifififlmgwgflgwwgfi 55.5.5EEE .55mm555: $555.55.Er.» _me5.5.5555c5530". ......................IVIWUHMWVW Dom........................................................................................ .mflwgfige 5555555555555555555555555555555 ....!h....V....N a LWWBEWE 7 m-rfizfia ' ' ' (Manna) Wuflm 5.................... _. ............... ................55115555111521 amalgam am...................................................................200 W 2. um'fiwfifi'dfifimm 55m ' arfia .................................................. 200 1W than firmW 2. 3113375 (afimfimmmmfimi'i, (finsussfifif mmmmmfimmmm nfi-mmm mafiafififimmmfifimfimfimnfi-mmfimm v ?%2_ Egazfiflmmwww sougaassfiwzwaswfiyfigsfi m.5...“-E... _ENE ?E23 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 34. THE GAZETTE OF INDIA : EXTRAORDINARY ' [PART H—SEC. 3(1)] 1. Wmmfimfiqumfimmdmfiamfil 2. mam(mafi)ammmmm I Egafimvnfifinfi GEESEEV II EVE» «E» -Hmmpfifl mum :mm (Wm 42 (4) (a) 2‘6?) maafim g;- . 3' l Hm ........................................ 1L“ ....-.“ THE GAZETTE OF INDIA :EXTRAORDWARY 113mm. 36)] 31w: - tfiifi. 9 (Em: 45 (1) (E1) 22%?) tfian farmmmmmmm. 2001 afimfmaaafisnfiflsmqfifififmrasmanfiafi 1. mmfiaww(ma¢a¢fifij ................................................. .2.. fimawrawqa:....................................................... mam : 31mm 3. Warm .................................*........................................ 5. mmmmfia ........................................... 6. w'mafiaifiam ......................................................... 9. WW imwfifimmfimwfifi fiw am ....................................... 2 mm?) ............................ _ "din fl 111m f6!!!W W .................... 1. gammaiqifimuamflzmm W§I . . mmmmmafima .4. wufisafiafimfimmfifismmfimtm mfiwqml WWW! 60 2 THE GAZETTE OF INDIA : EXTRAORDJNARY [PARTJI—Sac.36)] mi - #1211. 10 :5me .......................mmmfiy 1. 1%1‘1/311 ..................... WW,W0 ..................... aafilryfizfi 2. fimfiaamfia ......... _. ........ $W§mmfiwammwm ‘ (E) ....................................... WWWWI qamamfivamaaafiwqmfifil Erma ....................................... 200 ....................... W............................ . imam tf'lanfiimvfimfl (15W! 49-21:?) ° Wfimmmtafifiisfifiafi rfim .................amaafiafifififimfifiafiwa fiammwmfifiamwafimaafiz- mfifimrsqmamafivm ....................................................... filfia ................................... 200 E ............ flat {1 WEI? tfian film!W mm ....... -....—-..—-—-..u-—---—- n.--...—-——----..- ---- ---o-u-—---_—.-.——... a mermsmasmmsw ..........................sammarvmamm wmawfiamfiaflmafififififlmmfiqwfimmfifi I - wafififififimwfiufi-mmfimmml I Wm ............................... enf 200 fiat 1?. W. 1. afimmfiafimfitsmfiswfil 1113.1-111-11-1-121-11.»mi-11311-11-1191»1:11-31:12«1311.9'7 -11111-111-1131313;1311:.1-111-1-_>13_11e91-z manning), m- 11.11.44 [msuma] Wifihfifi-tmnfim Elm! .................... $ 61811;! m .. ............ '. ............................ 200.................... wmmmasmfifim’:................................... mmmmmfi Inimikfiimafimmmmmqfi Wufiwqfimfimml mg .......................................200 .................. W.............. mmmasm wwfimwfismmfil wmfimfimfismml mafimmmmafimfiml , V P P N 5LEE Faun. .m....229...E5 m a m a mafia.“ .............. . . ., ........... ............................ @mm 434 max agfifllfl A. 3ufiuafi_ \ 3 .344 J 4% q I ; :4 r! : 4 £1 2! g} mmommfiglmm m - 4! it - 10 oo1 mman-mtm mmmtmama a W ----------------- 1mW$W am?----------------- cammmww-m am --------- thin mmgfim ---------------------- 200-“--------- afimgfi.$W-fiéi mefifiamfififimfl mmfi mimi/éfifit wins -------------------------------- mini? 5 ------------- -----------------------6 ma _ twmasufimmamfia fifimmfifimm I azfinfiqmfiaafimml 3. Mammmfififidiaifi aafiwmfiatawmwws m Huron warm emu: Rafi! mm [mm as 1m afimé Ifi'fiefl 31w? faxam “£5 l 4. Wwwmmfigmw mfimam I I 6. fish [3:131 ®W$We’wflm$ :gauwhmrewaugnflwmgfimgwmmm Immwwvmammegmmaam Imamaggmpmggjgamag A1114+. o j c d w r t r i c o WMWHIQMWS................... EM vM'0“?'#131 Iu [mumsm] WNW:am 59 maammmwmmmfimmmfim afizflafifiaamqfiwfiafimml 1. summfimmfimm I mama ........................ rm................. 200 .............. mm ............................ Wit W. WWW, mmmmmmmqfi II m'mfimmmmmmaamn P P N T FREE! - tfizfi. 19 (film 57 éfi) :fian fism 31‘]? went; mail? ?imrn afififiwn, 2001 mien film] 733 $1??? fi' nfifé am}. fimafi w W? m as 1%“: W wfis am 31133:! t _......un..-..._.--.,_. ..... Wfimmfimmmmfiafimmmmsl 3‘ Wfiufifimfifiml 313E .................................... 200 .............. mm ............................ m1 1?. W. asafimaafiafiwfifimmfil mmmmmmqfil fi P F O N T massemmmmamamtzmh mam'17 Iammrm Iwammamflmwm'z m' m' mmmenemmwmuwywsemmhfi Igmmemwmmnm awm...............................................................................31.21; -um oz-u'wnl m-m.:n.—21 [fianfiflii] WWWWMWWJMI fifiamaufaf................... fimmfio ................ afifi afim’tmm wmfiifiwafimmmnfiamaflmil Gm!....................................2, fimfi. W. WWW waft! ........................................ 2. wafimmfimfiwfimwfimfifim) 3. Wsznmafiamfism 4. mfismmfifiinfimammfimmmml EEE .EEEBEEEE S é r i u s w-ioi Egfififififinfifiwggwggfi EMWEEWE.— «i EEEEEE .2SE... ,2.....2:E 74. THE GAZETTE OF INDIA : EXTRAORDINARY [PART [1—3112 3(i)J m - 1m. - 23 [Run 62 ad] mmmmmmmmjom afianfiqhadfi Warm ................... ?Iafimfifimqfiaflamma’fafi... .........................mfis’rml arfiamf .............. ‘ WEN.......... Wflmfiafil (film! 65 (1) ii) m: mm 3/2?! t:- amu ------------------------ zoo ----------- ma?---------- m i W. w (film 66 (2) iii) afimfifiwmfifi """""""""""""""""""""""""""""""""""" WEI m Erma 3 fig Wfimasfiwmwm’ ................... WWW cne'ks ------------------------------------- Hi 20 H‘ q: q Lfiul mow um 32% affim mam m afil 2. asaflfiqqfifiamfimmfifamtwmfiafififilfim Wail ml m-tfifl-ze mom)!!!» . m as rawm asm a?!m fimwmfiésafizfiasfifiaafimémwafi I fiwanarzwnfimfiffiqwmfifimmfimmtfifimfi‘ fimhmasmfifimmmmwmfiammm .Wiifirag: s,mxmaafi mmmqu m-fifi-zv (Emeumfi) mmmmmmmmjom Wimmfififiaafim €163??? g; Wmmfiammqmz 3W1???""""" innit, mam (hannufifi) firm------------------------------------------------ 80 THE GAZETTE OF INDIA ; EXTRAORDINARY [PARTflv-SBC. 3(1)] Wégl WTHEI- ‘ fimanimfififiimmwmmafimfifiw ariwrfiafiwfiamasmjmfiflfil ‘ ' mm ------------------Elf 200 mama, _ flimafiafimil 2. mmmmmmmaaasmaagmatawmmm mmfimml W715)“, mmtmm'tmam a x 'm' --__-_-—»-.._'.'_;-..a- ___—_;-a------------- 1131i. mm. [film 73(1) ii] as m .......................................... ........... .....qmfi 1. mfiafiafififihfifimm‘rvmmafiww I Wfil ammunmgmaafismmaawmmmmmw 51F! Waihfiflamfisaimmfifil fimwtfltfimi [mmmu] N mmmmmmmmam 84 THE. GAZETTE OF INDIA : EXTRAORDINAR‘II ‘ ; {PARTn—SEC. 3(1)] mmmmmmamfimfimmafiafimfim fimnmififimaai— mam???— wmafifiwarrmamafiwum am ....................EN 20 .............. flan? mmmwmm A mmaflafimi m tfilfi. 32 mammiimmwmmu 7H .........................Wm.....................................331111131? flm1 ............................ 2 ......................fianfimflaflv annuamfifitrawfimmt ammmwammasmfimwwmm ufiafliz’fafi mamamwam mm............ . ' (afimflmammvuafiww) Mi WWW!!! THEGAZETTEOF INDIA :EWINARY (W761!!!) ,mmmimmmm' ‘a ...................mama!......................8W1} m2 m1? 0W WWW 21M nmafiafirmi 1. Wmmlqnamymalammammmfil 3. wfifimmfimmmm'fimmmfimm? 4. miamfiasm ' -m311-1 (film 30213) afimhefi ................................is mmm/m ......................261311111 Mmmafi3a1=ffimrm€ ...................... mmmgmawfi': ..................... fivfimvwmmtmaamwmmfi .......... ...........arm: r111 ..................mevmm 1121131 E WI mmmmmmAt ...................a 31131th 2. mmmmhmmflmafivvfimfifiafiammfififiafi) .3. mfiafimmm ‘ 4 mmmnmiwm 88 THE GAZETIE OF INDIA : EXTRAORDINARY {pm“—331 3(1)] m- 0-2 (mhunssaihafifi) Wm-n 2000...............WWW....................... wwfiagmaqfimfiswfifimfimfiafivazmmmfimwmmfim mmfimufirfirfimwfififififiafiiwmmmammmfi afimfifiqfimmwfiiwmmmmwwfimm; Wfigwwagfi 11111111512110an Wifififimm.......... . ........... 111 ...............................................mfiafivwfiiqfimmmfafimfia ..............c.......................... Egg...» a53E. #10E wgfifiafigfigfimfisgwgfififlfmsmmgw Efifigfisfifig AMESEV 010E 90 THE GAZETTE OF INDIA : EXTRAORmNARY __ _ ‘ , _ 113m u—sEc. 3(1)] mama“ svfiiwfisafimwfia-maiwrfifiswfimafiwwwm fifiwfivwafivqswaffimwaffifimjomflammawffiawgfiufififififfifi 111m................... 20 ................... 0112111110 111 mm am 331 mo-S (12mm 47210") Wmafimfimmmw "Ho ...............................' _. [mnewaml .. . 111mm 7 _ 91 m 0-! (Wwfii meath Wfimfimfiamfimafimafim amau W'mewmmfiwwmafiml mmfimmasmmafiww 92 ..___ THE GAZETTE OF INDIA : EXTRAORDINARY [Pmfl—Sz; 391 m3“ 7 ( m 51 (1) 33 J wfimmfimfifivfifiwmm :fifififiiflfifiwmm?! ~ mwfiqfiimmmfimfimflmxfimm 'awmsm?! vim fi (1) WJWE m 31‘! 8 (mt; 53(1):}6) mamammwasmmasmmnmmmmammmm fil’flfi' ' 1 ............ fimfimm 3mm 2 wmafiwfifll (W59(1)3§) 1. mrw 3333.333 3353 333 3333333 THE GAZETTE OF INDIA : EXI'RAORDINARY [PART II-SEC. 3(i)] WNW2 mom 313333 3333333 2'3: 33331333333333.7(2) 3 mfiwmumfifii Wamfififlmw .................... 333 3333333 3:3320W WWW 1. mmmmfimmmmfinfifimfiim m0—11 (filmssi'd) mmmmmfimm mifqfiafifi ..... 3333363 3353331313f35333 ...................WW 3:1 ....................W313 ...................?I 313333313352333333333333 .................. . ......... $33333me....................M3333 .......................................am 251 am: ram mu 9m :na fan IN uflafia WWW mo-12 ' “(t .....................am...................#1 mmmmmara; ............................................................................ 113?}; mm fifimwmfimmfimfifiifimmw! mmmmmwmammmamra Mwfimiflmfiffiamfirufifigm ........... Efi am 113200 [111 1—4/2003/31 fi—V] 370 W“ 816:“, mafia 96 'I'HE GAZETTE OF INDIA : EXTRAORDINARY [?er MINISTRY OFAGRICULTURE (Department ongrimlhu-eand Coopent'mn) NOTIFICATION New Delhi. the 12111 September, 2003 G-SR- 733(E)-—1n exercise of the powers conferred by section 96 of the Protection of Plant Varieties and Farmers’ Rights Act,2001(53 of 2001) read with section 22 of the General Clauses Act, 1897 (10 of 1897), the Central Government hereby makes the ‘following rules, namely:---— CHAPTER I PRELIMINARY 1. Short title and commencement - (1) These rules may be called the Protection of Plant Vhrieties and Farmers’ (2) They shall come into force on the date on which the Act shall come into force. 2. Definitions - In these rules, unless the context otherwise requires, - (3) "Act" means the Protection ofPlant Varieties and Farmers’ Rights Act, 2001 (53 of2001); (b) "Authority" means the Protection of Plant Varieties and Farmers’ Rights Authority established under sub-section (1) ofsection 3; {3:} "Chairperson" means the chairperson of the Authority appointed under clause: (a) of subsection (5) ofsection 3; (d) “fee‘ means the fee specified in the Second Schedule; (e) “Form” means: Formmeeified in 11! First Schedule; (1) “Gazette”_nnms the Oflicinl Gazette fifth. Govermnem ofIndh;,. (11) “non-official member” means a member of the Authority other than a member, ex-officio; (i) “notice” means a notiée‘ issued by the Tribunal or the Registrar or the Audidfit'y ttfidéf the Act; (j) “Registraf’ means a Registrar of Plant Varieties appointed under sub- section (4) of section 12 and includes the Regime: General of Plant Varieties appointed under Inb-soction (3) ofthat section; (It) “Schedule" means a Schedule attuned to these rules; (1) "section" means a section ofthe Act; (m) ‘anmion” means any written eonummication addressed to the Auflaority or the Registrar in any proceeding under the Act; (n) all other words and expressions used, but not defined in these rules, but defined in the Act, shall have the meanings respectively assigned to them in the Act. 3. Detnils of particuhn to be furnished while making an application or representation - , . (1) Save in case of forms specified by the Authority under the Act, every person making an application or representation under the Act or these rules, shall furnish the particulars in the Forms specified in the Fint Schedule; (2) If any applieation or representation has been filed'fiflttfllt hh-xfishing all the particulars as specified in the relevant Forms specified in the First sewers; the Authority or the Registrar, asthe cm may. 15%, 31%“ give one month’s notice to the applicant or the person, who has filed the applteattett at 1115 representation to file such paiticulars., (3) In the event the applicant or the person, Who hifi 11166 the ibfiltedtifih 61‘ thé‘ representation, defaults or title to natty the” appli‘c‘fitidn or the representation, as the case may be, in terms of the notice under sub rule (2) within one month as allowed, the said applicatiah 69916 Wtatiott shit“ be liable to be rejected without any fiu'ther notice. (4) Where no Form is specified for my-purpege the hphiieant ’may adept “at; nearly as may be a Form specified in the First Schedule with such modifications and variations as may be considered fléééhs‘fifih 4. Officeof the AuthOrity - (l) The office of the Authority shall, for' 5111' proceedings hhflEr the Act. be the head office of the Authority at New Delhi hr' the‘ braneh bffice, as the case may be. within whose territorial limits} -— (a) the applicant for registration of the plant variety or the farmers” right has his prineipal place of business or domicile; or (b) the applicant fer registration of the plant Variety or the farmers’ right. whose name is first mentioned in the application, resides or has his principal place of business or domicile, if the application is made jointly in the names of two or more persons; or (c) the agent or licensee of the registered breeder has his principal place of business or domicile. (2)NM' - -‘ comma ll! cultural: (1), mil the branch emcee m eemhhshed, the qipropflate office fin ell procee'dhlgs under the Aet-sh‘all be themed ofic‘é‘at‘m’e-mthyum Delhi. Addreu for nrvic‘e of notices, etc. (1) Every person includh'tg the epplio‘mt, oomemed in my proceeding to which the Act or these rules wig, §ih‘iilWmite Authority or the Registrar the complete address rot mice in IndiamMmthin tomfor all purposes oomected with such pmeeedih‘gs or the fightE‘mb the addms ‘ ofthe person or persons iii the precluding; (2) Unless such an address is given, the Authority em Registrar Ihnll be under mobhgatioheithertoproeeedetdeelwhhanyptowedingofwiendany notice that may berequi'redtti tie givenundmhe Act orthese rules.- . Procedure regerdlhg eppflctttlUfl; representation and blue of notices - (1) Every applicatitm or representation than in made in mm, signed by the applicant or the persdfi who hits nude the Wprefientatimh and delivered to the Registrar or the Authority at its office. (3) The names and hdthesses of the applicants and other persons shall be given in full, together whhtheii‘ nationality and such ether particulars, as are necessary for their identifiéation and for sending conuhuhietttiem ta them. (4) (a) All applications, reptesentations and documents filed or required to be filed uhder the Act or the rules shall be filed in triplicate; Provided that in cases where the Registrar or the Authority requires more than three copies of such applications, representations, or docmttemathe applicant or the person, who has filed the application or "the ‘re’pi'csentetion, shall be required to supply as many copies as is ' specified by the Authority or the Registrar. 100 THE GAZETTE OF INDIA 1EXTRAORDINARY _ _ [Pm11753; 3(1)] (b) In case of failure to furnish the required number of copies within a period of three months, the Registrar or the Authority may reject the application or the representittion or may treat the application or representation ‘tts withdrawn. (4) Any application, representation or document required to be sent to or filed with the office of the Authority or the Rfiiattat‘ may he delivered either by hand or by registered letter with ackmwledgement due or electronic mail, addressed to the Authbrity or to the Registrar at their office (5) If any application or a representation or doeument is delivered to the Authority or the Registrar by hand, an acknowledgement receipt shall be issued by the Authority or the Registrar’s Office with its sealT (6) In case of delivery by registered post with acknowledgement due or by electronic mail, it shall be presumed to have been filed, or given at the time when the same has been received by the office concerned. (7) Any written communication addressed to an applicant or the holder of any right under the Act, at his address in the Register of Plant Varieties maintained under the Act or at the address for service furnished under rule 5 in any proceedings under the Act or these rules, at the address appearing on the application or notice of opposition or reply or counter reply or any such representation, shall be presumed to be properly addressed : Provided that in cases where the receipt of such a'representation or application has been delayed beyond the normal period of delivery or transmission, such a delay may be condoned. (8) All notices and written communications addressed to an applicant or to any holder of right, in any proceeding under the Act or these rules, and all documents forwarded to the applicant or the holder of any right or an opponent shall, except when they are sent by special messenger, be sent by registered post acknowledgement due or by electronic mail. (9) (a) The ackmwledgemn meetpt inlet! by theoflice concerned or the 'poetateenifieateteeeiptshaubethesutticiemmootutothedehveryor sendingofanydocumentunderthefitetortheeerules. thereeognleeddigital signature, bytheapplicam orthepersomwhohas mdeflwrepreeertetbmshnllbetheproofoffltereeeipt. ' No application armada! shall be tmde to ’the authority or :egistrar coming the wbject—mflter1M included inn earlier application made by the same person, and suehmhequentapplicationshall not be admittedbytheregistrarortheamlmrttymsthecasenuybe. 8. Fees- (1) The amount of fees payable in respect of the registration of plant varieties and grant of any ‘right under the Act or any application or notice of opposition or reply or counter reply required tube filed under the Act and other matters shall be as per the rates specified in the Second Schedule. (3) (a) The thee payable may either be paid in eesh of ”may be sent by money order or postal order ‘or bank draft or cheque payable'to the Authority or the Registrar, as the case may be, at their respective. otfices, drawn on a scheduled btink at the place Where the office is situated. . ' Explanation : For the purposes of these rules, “scheduled benk” means a bank included in the Second Schedule to-the Reserve Bank of India Act, 1934 (2 of 1934). (b) Any cheque or drafi (not includih‘g the fees in cash) on which the value specified therein cannot be Imllected in cash within the time mowed fer the payment of-the fees, shall he accepted at tlte discretion ' ofthe Registrar. (c) The stamps shall not be received in the payment of any fees payable under these rules. ((1) Where a fee is payable in respect of the filing of a document or application or representation, the date on which the entire fee is paid shall be the date of filing ofthe document or the representation. (3) Where any test is required to be conducted under any of these 'rules, the applicant or the concerned person shall be. required to pay the requisite fee specified in the Second Schedule. I (4) Any application or representation or document shall be liable to be rejected on account of non-payment of fees and no test shall be conducted unless and until the parties interested deposit the required amount of fees as specified in the Second Schedule. Size, etc., of documents - All documents and copies of documents, except afiidavits and drawings, sent to or lefi at the office of the Authority or otherwise muddled t9 the Registrar shall be written, typewritten, lithographed, or printed (either in the Hindi or in the English language unless otherwise directed or allowed'by the Authority or the Registrar-General) in large and legible characters with deep indelible ink with lines widely spaced upon one side only of strong white paper of a size of approximately 33.00 centimetres by 20.50 centimetres (13 inches by 8 inches) or 29.7 centimetres by 2} centimetres (ll 3/4 inches by 8 1/4 inches) with a margin of at least four centimetres (one and a half inches) on the lefi-hand part thereof. 19- meet -,. I Theafiidavttsmqunedtobefileduwerthesemleeshallbedatedml Ids smatheieotaedsbanmmhmtmmdmttwmmdmattpm -‘ Min are true to the best ofthe kmwledge, intbrmationend belief ofthe persbnmakingflteaffidayit. ‘ CHAPTER II 9WVARIETIES AND FARMEBS’ RIGHTSPROTECTION AUTHORITY (l) The Chairperson shalt be appointed by the Gemini] égyemment on the basis of a panel of names mended by 'a QSeleet'nn Committee (a) Secretary, Department of Agriculture and Co-opentfin. éfvernment (b) Secretary, Department ofAgriculture Reeearch and Education. (c) One Expert nominated by Ministry of Agneultute, Govermnent of India— Member (2) The Department of Agriculture ancl- Coopelatton9? fix“Central ‘ Govenmtent shall act as the nodal Wat £0: thegelection arid Government of India and the appointment as chahWn-shall either be on deputation oroneontract basis. (4) If the Selection Conunittee mmtitmed t-ger sub t_ule -(l)_, recommends any person who is not a government servaht but fulfills 104 THE GAZETTE OF INDIA : megamagy [FARTII—Sw 3(1)] quaiifications given in clause (a) of sub-section (5) of seetism 3, egg}; appointment may be made on contract basis. 12. Term of Office of the Chairperson - The Chairperson shall hold office for a term of five 3mm 9; up t9 the age of sixty-five years, whichever is earlier, and shall be eligible [hr re- appointment: Provided that no Chairperson shall hold office, fl)!“ Q natal E??ied exceeding ten years, or after he‘ has attained the age Of sixtyefive $9813, whichever is earlier. 13. Salary, allowances, conditions of service. have, mm, provident fund etc. of the Chairperson - The Chairperson shall be entitled to such salary, allowamest ism: pension, provident fund and other 'perquisites as are admllsiblo to 11 891333;? to the Government ofIndia. 14. Resignation or removal of the Chairperson from ofilee III ccflllll em - (l) The Chairperson may resign fi'bm his office by giving notice in writing to the Central Government. (2) The Central Government shall remove the Chairperson fi'om office if he. v (a) is or at any time has been, adjudicated as an insolvent; (b) has been convicted of an offence which, in the opinion ofthe Central Government, involves moral turpitude; (c) has become physically or mentally incapable of acting. as the Chairperson; ‘ (d) has failed in discharging the duties and responsibilities under the Act and the rules made thereunder; (c) has acquired such financial or other interest as is likely to affect prejudicially his function as the Chairperson; ’ (i) m; m the 99mm ef'the Central STWem, so abused his position as to render his continuation in office detrimental-to the public interest; (g) any other substantiated ground which is unbecoming of a public servant under. the Government ofIndia : Provided that the chairperson shall not be removed under this sub-rule unless he has been given a reasonable oppommity of being heard in the matter. ' 15. Term and Ilhwanm ofnmeamoial members - (1) Every non-ofiicial member of the Authority shall hold office for a period 0fthree years fiom' the date ofhis appointment. (2) The Central Govemment shall appoint new nonnofficial member of the Authority within six months of the, expiration of the term of the non- ofiicial member. (3) A non-ofi'lcial member shall be entitled to sitting allowame and travelling expenses, at such rate as may be fixed by the Central Governmem from time to time in this regard, 16. Proceedings of the Authority - (l) The Authority shall meet atleast twice in 11 yea: at the head quarters of the Authority or at such place as may be decided by the Chairperson. (2) The Chairperson shall, upon a written request of not less than five members of the Authority or upon a direction of the Central Government, call a special meeting ofthe Authority. (3) At least fifteen days' notice of an ordinary meeting and three days' notice of a special meeting specifying the purpose, the time and the place at which such meeting is to be held, shall be given to the members. 106 THE GAZETTE OF INDIA ; EXTRAORDINARY [Pmn—Sm 36)] (4) Every meeting shall be presided over by the Chairperson and in his absence, by a Presiding Officer to be chosen by the members present fi'om amongst themselves. (5) The decision of the Authority shall be taken by a majority of the votes of- the members present and voting and in the event .of equality of votes, the Chairperson or in his absence, the member presiding over the meeting shall have a second or casting vote. (6) Every member shall have one vote. (7) The quorum for the meeting ofthe Authority shat! be five. (8) No member shall be entitled to bring forward for the consideration of a meeting any matter of which he _has not given ten days' notice t9 the Member—Secretary unless the Chairperson, in his discretion, permits him t9 do so. (9) The notice of the meeting may be given to the members by deiivering the same by messenger or sending it by registeted post ta bis lag; known plgeg of residence or business or in such other manner as the Chgwyaersob 9f the Member-Secretary may, inthe circumstances ofthe case, think fit 17.. Chairman and proceedings of the Standing Committee - (1) The Chairperson shall select a member of the Standing Committee appointed by him under sub-section (7) of section 3 from amongst the members ofthat Committee to preside over its meeting. (2) In the absence of the member selected under sub-ruie (l), the meeting of the Standing Committee shall be presideti over by the member who shall be elected by the members present at meeting from amongst themselves. (3)3116 decision in the meeting ofthe Standing Committee shall be taken by a majority ofthe members present and voting and in the event ofequaiity of votes, the member selected under sub-rule (1)2or in his absence, the member presiding ever the meeting shat] have a second or casting vote. h ' ‘ (4) Every member Shall have one vote. g5)“t‘hu:qumttm {hr the. meeting uflhe Sumding Committee shall he three. _(5) The eomtener ef the Standing Committee may, in consultation )Niih the Authgfity, determine the venue of its meetings any where in India; and serve nohee-efsheh meeting “3 £11! menwfls at least fifteen days in advance. 18. khfi’éfitfimfit st Elem Committee by the Authority - (1) The Authority may appoint such experts or consultants as it considers mummy to seek guidance and assistztege,yin teehnieal, areag demanding Specialized advisory inputs, to egaable the Authority for efficient discharge of it: defies ens! fitflciiflfls- , (2) Tbs Antherity may appoint such other eommittees as my be necessary fer the sffigicnt discharge of its dutics and functions. ' (3) The Authority may. in eonauhatien with the Central Governmentffix ‘ the quantum of remuneration. payable to the experts and consultants. 19. leluy. Anewggssg gee Eghflgtjgps ot‘ genice ot’ the Registrar—General — (l) The Registrar—General shall be QR 99"?qu egHivalcnt t0 the tank of the Additional §emetgry to the Government of India and he shah be appointed by the Authmity ga- 9EPW§HPG _or transfer or on conttflet haste: (2) The Registrar-Geheral shall be goyerttfifl hx thg £38935}! .‘Ggygmment rules in {sweet of his salary and other aflowances including pension, leave. tmvelting gag §§in allowances as are admissible m an Aqtthionel Secretary to the Government aflndiag (3) The decision in the meeting of the Standing Committee shall be taken by a I majority of the members present and voting and in the event of equality of votes. the member selected under suh—rule (I) or in his absence, the member presiding over the meeting shall have a wcond or casting vote. (4} Every member shall have one vote. (5) The quorum for the meeting of the Standing Cornmittee shall be three. (6) The converter of the Standing Committee may. in consultation with the Authority, determine the venue of its meetings any where in India; and serve notice of such meeting to all members at least fifteen days in advance. I8. Appointment of Expert Committee by the Authority - (1) The Authority may appoint such experts or consultants as it considers necessary to seek guidance and assistance in technical areas demanding specialized advisory inputs, to enable the Authority for efficient discharge of its duties and fimctions. (2) The Authority may appoint such other committees as may be necessary for the efficient discharge of its duties and functions. (3) The Authority may, in consultation with the Central Government,'fix the quantum of remuneration, payable to the experts and consultants. 19. Salary, Allowances and Conditions of service of the Registrar—Gcneral - (l) ”The Registrar-Gcneral shall be an olTicial equivalent to the rank of the Additional Secretary to the Government ufindia and he shall be appointed by the Authority on deputation or lrzlnsfer or on contract basis. (2) The Registrar-General shall be governed by the Central Government rules in respect of his salary and other allowances including pension, Ieave,_ trayelling and daily allowances as are admissible to 'an Additional Secretary to the Government oflndia. V (3) The Registrar-General shall bewa person haying proven manageriai, or legal or Intellectual Property Rights or agricultural development experience. . (4) The term of office of the Registrar-General shall be a period of five years or until he attains the age of sixty years, whichever is earlier : Provided that no candidate who may not have at least two years tenure in the office shall be appointed as Registrar-General. (5) A person on completion of one term as Registrar-General shall be eligible for a seeohd term of three years or until he attains the age of sixty years, whichever is earlier. The method 10‘ appointment of oflieers and other employees of the Authority- ' ' (l) The Authority may make recruitment ahd appointment to the posts of_ officers specified in the Fourth Schedule. (2) The Authority shalt after Advertising the posts in the Employment News and atleast one national daily recruit officers and other employees of the Authority by the method of direct recruitment or contract basis by selection after conducting interview. (3) Notwithstanding anything contained in sub~rule (l) and subject to the approval of the Cehtral Goyernment the Authority may also appoint such other officers and employees as may be required by it on transfer or deputation basis or on contract basis. (4) The salary, allowances and other conditions of service ofthe officers and employees of the Authority shall be the same as appiicable to Central Government servants of equivalent rank. (5) If any question on the service conditions of any officer or employee of the Authority arises, it shall be decided by the CentrafGovemment. Powers and Duties at the Chairperson - (1) In addition to the duties specified in the Act, the Chairperson shall have _powers of general superintendence and directions 'm the conduct and mnagement of the afiairs of the Authority, to enable the Authority in 110 THE GAZETTE OF INDIAzEXTRAORDI‘meh/gxw A [PmlI—slacaml effectively discharging its duties and overseeing the compliance of the provisions ofthe Act, and the rules and regulations made thereunder. (2) The Chairperson shall also discharge such other duties and fimctions as the Authority may by general or special order in writing delegate to him or the Central Government may authorise him to discharge fi’om time to time. I (3) The Chairperson shall convene, preside over and conduct the meetings of the Authority and be responsible for carrying out all decisions taken by the Authority. (5) The Chairperson shall guide and facilitate the development of new pli'nt varieties by protecting the rights of the breeders, researchers, farmers, and community of farmers as provided under the Act. (g) The Chairperson shall facilitate and act on his satisfaction for compulsory licensing of registered plant varieties and advise the Central and the State Governments on the restriction of public use of any such registered plant varieties which may invite action under sub-rule (4). 22. General functions of the Authority - (l) The Authority shall advice the Central Government in relation to the provisions contained in the sub-section (2) ofsection 29 for specifying and notifying the genera and species for the purposes of registration of new piant varieties other than extant varieties and farmers’ varieties. (2) The Authority shall register extant varieties under clause (a) of subsection (2) of section 8 within such period as may be determined by it with suitable test criteria to conform distinctiveness, uniformity and stability [hereinafier referred to as DUS) ofsuch varieties. (3) The Authority shall develop DUS test and other test criteria and conduct such tests for characterization of each variety of crop species notified by the Central Government. [‘WTII'e-Wjfifl fifilmtmm comma knowledge including all registered extent and ranmrs' varieties and suchvarieties being cultivated outside India for each crop species prior to grant for registration for new varieties belonging to such species. crepvarietyunderuseintheeountrylhrthepurposeofh-ingmgfliesame intoitsdatabase. (6) Any public or private institution, community or individual involved in the production and-use of seed of such varieties shall be required to provide full information on its characteristics or and a true sample of seed of such variety. (7) The Authority shall keep a record 0fthe production and sale of seed of all registered varieties. (8) It shall be necessary for all breeders of legistered varieties to supply certified figures on annual seed production and” sales to the Authority within a period not exceeding three months from the completion of such reporting period. (9) The Authority, if required shall also be entitled to call for such figures specifically relating to any region ofthe country. Matters to be included in the National Register of Plant Varieties - The National Register of Plant Varieties shall contain the following particulars of each registered variety, namely: - (1) Registration Number; (2) Nationality of Breeder(s); (3) Denomination as granted; (4) Date ofGrant of Registration; (5) Date on which application was received; (6) Provisional number given to the application; Ill HZ THE GAZETTE OF INDIA : EXTRAORDINARY [Pmflrk3m (8) Grouping ofthe plant variety (new, extant or farms); (9) Classification ofthe variety (typical variety. hybrid variety or minus; derived variety); (10) Denomination ofvariety, Common Crop name to which theWW belongs, Taxonomieal Lineage ofthe Cmp in Botanicalm; l (l 1) Key Passport data ofthe variety; ([2) Essential characters making the variety distinct; (13) Starting date of protection; (14) Expiry date ofprotection; (15) Date ofrevocation with other details (grounds etc.); (16') Name and address ofthe applicant(s); (l7) Address for service of document(s); (18) Name and address ofthe breeder(s) (in case breeder is not the applicant); (19) Name and address ofthe legal representative (if applicable); (20) Name, address and other details ofthe licensee and terms of license (if applicable); (215 Name, address and other details ofthe agent with jurisdictional rights, if any (if appointed); (22) Type of crop; (23) Name ofthe family, genus, species, variety and common name; (24) Name and address ofthe breeder of initial variety (in case ofessentially derived variety); ,_ (25) Details of the acquisition ofpropagating material/ mds (if applicable); (’26-) Detaih ofparental material used in the development (if'applicable); (27) Name and address of the contributor(s) ofgenetic material (if applicable); (28} Any othet feature specified by the Authority or Registrar-General; (29} Country oforigin ofthe plant variety; (30) Brief description of the variety along with characteristic details ofthe nearest variety including results ofDUS testing, supplemented with the drawings or photographs or both; (31} In case ofcompulsory licensing, name and address of licensee with other details (terms and conditions, revocation, etc), if applicable; (32) Declaration and details ofthe renunciation to the variety (ifapplicable); (33) Details of benefit sharing; (34) Details ofopposition revocation. restoration. maintenance (wlmtever applicable); (35) In the ease ofvatt‘eties proteeted outside India priorto tegistmtton inthe Country, follOwil‘Ig additional informtion shall be entered in the National Register ofplant Varieties namely: - (a) Name ofthe cbunttflles) where protection ’5 made along with the denomination ofthe "variety in each ofthem. ' (1)) Date offirst ptfitection with country, (0) Variation in important trait with respect to first filing, (d) Country wherein the Variety was first commercialized with date, (e) Any other feattit‘é Wified by the Authority or Registrar-Gemal; (36) In ease ofa- convention appliéétifiht the $110me information shall also be fiimished, namely :- y (a) Name ofthe convention ediihtry (b) Passport data ofthe convention apfilieatlen (t) Denomination as accepted (g) Date of Gazette notificatieti (h) Starting date ofprotection (i) Expiry date ofprotection ‘ (i) Whether the variety has been sold or'etlmwise disposed ofwithin and Outside the country, if so; details thereof (37) Any changes made in any entry. CHAPTER III REGISTRATION OF PLANT VARIETY 24. Registration of Extent Plant Varieties under sub—section (2) of section 15 - (1) The Registrar shall register every extant variety within three years from the date of its notification under the Act, with respect to the genera and species eligible for registration subject to conformity to the criteria of mam “" distinctiveness, uniformity, and stability as laid down under the regulations: Provided that the Registrar may, for reasons to be recorded in writing, register an extant variety after the expiry ofthe said period ofthree years. Application to authorize a person to register a variety under clause (e) of sub-section (1) of section 16 » An application to authorize a perSon to register a variety under clause (e) of sub—section (1) of section 16 shall be made in Form PV-l, given in the First Schedule, by a person specified in sub—section (1) ofthat section. The fee payable under clause (g) of sub—seetion (l) of section 18 for making application for registration of plant variety - The fee for making application for registration ofa plant variety under section 14 shall be such as specified in column (3) of the Second Schedule for the purpose, Proof of the right of making application under sub-section (3) of section (1) Where an application for registration is made by the successor or assignee of the breeder under sub-section (3) of section 18, he shall furnish documentary proof, at the time of making such application or within six months of making such an application, as to the right to make such an application for registration. (2) The documentary proof, in case of an assignment, shall be furnished in the manner specified in Form PV - 2, given in the First Schedule and in case of succession, or a succession certificate or any other document in support of succession proving the applicant to be the successor shall be furnished. 26(36lt‘2603—88 28. Fee for conducting tests under section 19 - The applicant shall depesit the requisite fee for the purpose as spee‘ifled in column (3) of the Second Schedule, with the Registrar for eonducting the required tests under section 19. 29; Manner and method for conducting tests under section 19 - O (l) (a) The Authority shall chargeseparate fees for conducting DUS. test and special test on each variety. .. (b) The special test§ shall be conducted only when DUS testing fails to establish the requirement ofdistinctiveness. (c) The DUS-testing shall be field and muhi-locatitm based for at least two crop seasons and Special tests be laboratory hm. (d) The fee fot- DUS and special tests 111ml] be such as provided in column (3) ofthe Second Schedule for the purpdse. (2) 1f the Registrar, after initial scrutiny of the application lb! registration, is satisfied that the application is in 011131.110heshall notify the applicant to deposit the requisite fee, as specified in column (3) of the Second Schedule, within a period oftwo months for conducting the DUS test. (3) On receipt ofthe fee, demanded under sub-rule (1), the Registrar shall consider the application for further processing. (4) The DUS test shall be necessary for all new varieties except essentially derived variety. (5) The manner of testing essentially derived varieties shall be decided by the Authority on a case-to—case basis. (6) The DUS test shall be conducted on a minimum oftwo locations. 116 _THE‘GAZETTE OF INDIA ‘. EXTRAOMJINARY ~ _ _ [PARIlI—SECJQ] (7) The Authority may reco—gmze Hand empanel institutions having adeqmte faeilities'for conducting DUS or special tests in the 66mm")? for eonducti‘ng such tests. (8) The Authority shali notify the adopted methbds of eonducting the DUS and special tests. ‘ (9) The Authority shall develop and publish in its 10111-11111 guidelines for the DUS test for each crop. (10) The samples of seeds or propagules in respeet of which an application for registration has been made and pmntil lines under registration submitted for the DUS and special tests and deposited at the Nationel Gene Bank shall present the nmintainable standards of genetic purity, and uniformity and germination, sanitary and phirtosianitary Standards. Advertising of application for registratim’i iiidél‘ Mon 21 - Every application for registration of a variety which has been accepted and the details thereof including specifications shall; upon such acceptance under sub- section (1) of section 20, be advertised by the Registrar in the mmmer specified in Form — 0.1 ofthe Third Schedule. ' In every such advertisement under sub-rule (1), the Registm shall mention the place or places where a specimen ofthe variety may be inspected. The contents of such advertisement shall include - (a) name, passport data and source of parental line or initial variety Used to develop the variety in respect of which an application for registration has been made ; ([3) description of the variety bringing out its character pmfile as specified under the DUS test Schedule ; (c) essential characteristics conferring distinctiveness to the variety ; (d) important agronomic and commercial attributes ofthe variety ; ‘ (e) pht1tegthphs or drawings, ifany, ofthe variety submitted by the applicant; and . (1’) claim, ifany,onthevariety. 31, Notice of opposition under aub-aection (2) of section 21 - (1) Any interested person, may within three months fi'om the date of advertisement of an application for registration, may give a notice of opposition to the registration of a [312m variety in Form PV—3 of the first Schedule. (2) The fee payable for filing an opposition referred to in sub—rule (1) shall be as specified in column (3) ofthe Second Schedtile : Provided that no such fee shall be payable in respect of an opposition made by a farmer or group of farmers, or village community. (3) A copy each of the notice of opposition received against a specific application shall be referred to the applicant by the Registrar within three months from the last date of filing ofopposition. (4) An applicant shall be entitled to submit point-wise counter statement to the opposition not later than two months from the date of service of the copy of the notice of opposition, failing which the Registrar shall decide the merits of the opposition and notify his decision by giving reasons therefor. (5) Every coumer-statement under sub-rule (4) shall be in Form PV-4 of the First Schedule. (6) The copies of counter to opposition submitted by the applicant within the time specified in sub-rule(4) , shall beeonveyed. to the person opposing the application, within a period of thirty days of its receipt, requiring the opposing person to submit the final opposition within a period of thirty days fi'om the date of service ofthe counter fi-om the applicant. 118 THE GAZETTE OF mDIA:EXl'RA01}_D_1NARY [PQMII—Sm 3(1)] (7) The Registrar, may at his discretion, allow any correction 9f atmt'mw amendments in the notice of opposition 0t epunter statement if such alteration is requested by the persons concemd in writing (8) (a) The security referred to in sub-section (8) of section 21 shall be payabie as an amount decided by the Authority. (b) In ease the opposition is found to be fi‘ivolous, the Registrar may direct payment of cost as determined by him to the applicant from out of the security amount received and the balance of the security amount shall be deposited in the Authority. (0) In case the opposition succeeds, the security amount shall be refunded » to the opposition party. 32. Compliance with Time Schedule — (1) The time schedule provided'for advertisement, opposition, defence, hearing and amendment of specification under these rules shell not be extended and failure in compliance with these time schedules shall forfeit the Oppommity granted. 33. Manner of submitting evidence and time limit for fillng_noflee of opposition, counter—statement or producing evidences under section 21 - (1) Any evidence, upon which the opponent may rely, shall be submitted in duplicate to the Registrar with a copy to the applicant within one month from the receipt ofcounter-statement ofthe applicant. (2) Any evidence upon which the applicant may rely shall be submitted in duplicate to the Registrar with a copy to the opponent within thirty days from the date ofreceipt of opponent’s evidence. (3) No further evidence shall be submitted by either party except by leave or directions ofthe Registrar. (4) The copies of all the documents, except plant variety application, referred to in the notice of opposition or in any counter-statement filed in connection with the opposition shall be in triplicate unless the Registrar directs otherwise. (5) Where a document, is in a language other than English, and is referred to or relied upon in the notice, statement or evidence, an attested translation in English thereof shall be fittnished in triplicate. (6) The time-limit for filing the evidence shall not ordinarily be extended except by a special order of the Registrar given on an application filed by the person seeking extension of time and on payment of the fee specified in the Second Schedule and such an application for extension shall be in Form- PV 5 ofthe First Schedule. Application for the registration of essentially derived variety under section 23 - (1) The application for registration of an essentially derived variety shall be accompanied by the following documents, namely : (a) an affidavit sworn by the applicant stating that such a variety does not comain any gene or gene sequence involving terminator technology; (b) a statement giving details of the brief description of the characteristics of the variety to substantiate novelty, distinctiveness, uniformity and stability; and (c) the details ofparental material used. I (2) The application under sub-rule (1) shall be accompanied by the fee as specified for the purpose in column (3) ofthe Second Schedule. Manner and method for conducting test under section 23 - The tests referred to in sub-section (3) of section 23 shall be conducted by the Authority in censultation with the Central Government. 120 THE GAZETTE OF INDIA 1 EXTRAORDINARY [P_Alt’Ifl-v—SEC 3(1)] 36. Certificate of registration under section 23 - The Registrar shall issue to the applicant a eettifieate of registration of an essentially derived variety in the manner specified in Form 0~2 of the Third Schedule and send a copy of the registration t9 the Authority and to Such other body (ies) as may be notified by the Central Government tbr information. CHAPTER IV REGISTRATION AND BENEFIT SHARING 37. Certificate of registration under section 24 - (l) The certificate of registration of a plant variety, other than an essentially derived variety, under sub-section (2) of section 24 shall be in Form 0-2 of the Third Schedule. (2) The Registrar shall issue the certificate of registration under sub—section (2) of section 24 within three years of the date of filing of application subject to the fulfillment of all other requirements. (3) A copy of the certificate of registration issued under sub-section (2) of section 24 shall be sent to the Authority; and to such other body or agency, which the Central Government may, by notification in the official gazette specify. 38. Notice to the applicant under section 24_ - (1) If, within a period of twelve months, the application for registration of a plant variety other than an essentially derived variety is not completed in the circumstances given in subsection (3) of section‘24, the Registrar shall issue thirty days notice to the applicant at the address ofhis principal place of business in India, or if, he has no principal place of business in India, at the address for service in India stated in the application, but if the ' apphamhsemhmiudanagemfitrflnptnposeoftheappheatbnthe notieeshnllbesemtotheagentandaduplicatethet‘eoftotheepplieam for completionofregistmtbn.‘ r Schedule. 39. Renewal and revision of registration under section 24 - (1) (a) On receipt of an application 'fi'om the applicant, the Authority may review and renew the initial duration of registration as mentioned in sub- section (6) ofmien 24. (b) Every application for review and renewal under sub-rule (1) shall be made in Form eve of the 1.21m Schedule and filed during twelve to eighteen months prior to the expiry ofthe initial period ofregistration. (c) Every application under sub-rule (1) shall be accompanied with the fee payable for the remitting years under the initial period of registration, at the rate fixed for the year preceding the year of applicatiOn, along with arrears, if any. (2) (a) The renewal of registration may be applied for either for the remaining period of total aggregate duration of validity of the registration or for any period within such remeining period. (b) In case, the applicant prefers for a period less than the total aggregate duration, no application shall be entertained for the further renewal of (3) (a) The fee payable for such extended period of registration beyond nine years in the case of trees and vines and six years in the case of other crap varieties, as the ease may be, shall be based on average annual fee levied during the last two years ofthe said initial period ofregistration. (b) The annual fee shall be uniform for the extended period of the registration and be payable in advance in single instalment. (4) The Authority shall within such intervals as it thinks appmpriate publish a list of varieties registered as well as renewed under the Act with the particulars of the period of registration, name and address of right holders periodically in its journal and in the Oflicial Gazette. 40. Publication of contents of the certificate inviting claims for benefit sharing under section 26 — Upon the issuance ofthe registration certificate under sub-section (8) of section 23, or sub-section (2) of section 24, the Authority shall, for the purpose of inviting claims for benefit ”sharing under the Act, shall advertise the following details ofthe registration certificate, namely - * (a) the registration number along with the date ofgrant, (b) the name and address of the applicant or breeder in whose name the certificate has been issued or registered, (0) denomination ofthe yariety, (d) name ofthe family, genus, species, variety and common name, (e) parentage and geographical location ofthe variety, (0 the details of the distinguishing features or the characteristics, (g) in case of ‘essentially derived variety’, the details of the ‘initial variety’ fi'om which the ‘essentially derived Variety’ is claimed to have been derived. (h) the name and address of the contributor, nature and amount of the contribution or the community knowledge used in the development of the plant variety. (i) the terms and conditions of the agreement, if any, entered into between the breeder and the contributor. (j) if the variety is sold or otherwise disposed of, details thereof. 41. Benefit sharing chin under section 26 - (1) Upon the publication of the particulate of a certificate under wb—section (1) of section 26, a person or group of persons or firm or a non— governmental organimtionean make a claim under subsection (2) of that section for‘benefit sharing in Form PV-‘I of the‘Fint Schedule within a period ofsix months fiom the date ofsuch publication. Provided that in special circumstances, the Authority may extend the time limit beyond the period ofsix months. ' (2) The person or persons or firm or the nomgovemmental organization, who has made anapplication for benefit sharing, shall provide the following infermation, namer : (a) the contribution made by the person or the group of persons or firm or community or the non-govemmental organisations to the genetic development ofthe plant variety ; (b) the capacity in which the persou or the goup of persons or the non- govemmental organisation is making the claim for benefit sharing ; (c) in case of “essentially derived varieties”, the terms and conditions in which authorisation has been giveh ; (d) the commercial viability or the actual market performance of the variety so registered. (3) An applicant for benefit sharing shall pay the fee as specified for the purpose, in column (3) ofthe Second Schedule. 42. Opposition to a claim for benefit sharing under section 26 - (1) On receipt ofa copy ofthe claim for benefit Sharing, the registered breeder of the plant variety may accept the claim and accordingly intimate the same to the Authority within a period of three months from the date of such receipt. (2) In the eventuality of the plant breeder faltmg or defaulting to tender the intimation under sub-rule(1) within the period of three months, referred to in sub-rule( 1) it shall be presumed that he has no opposition to such claim and the claim shall be decided accordingly. (3) if, within a period ofthree months ofreceipt of notice ofclaim, the breeder of the plant variety flies his opposition to the claim for benefit sharing, such an opposition shall be taken into consideration while disposing 0r deciding the claim for benefit sharing. (4) Every notice ofopposition, under sub-rhle(3) shall be in Form PV-8 of the First Schedule. (5) The Authority, upon receiving the reply from the registered breeder, shall furnish a copy ofsuch reply to the claiment for benefit sharing. (6) The registered breeder or the claimant to benefit sharing shall finish supporting document and other evidence, which shall be duly considered by the Authority while disposing ofany claim for benefit sharing. Determination of benefit sharing under section 26 — The Authority shall, by order, determine the amount ofbenefit sharing to a variety according to clauses (a) and (b) of sub-section (5) of section 26 and taking into account the following criteria, namely - (a) the contribution of the claimant in selecting, conserving and providing the genetic material, (b) the contribution of such genetic material in providing one or more traits which conferred high commercial value to the variety, and (c) the contribution of such genetic material to impan high combining ability to the parents ofthe hybrid variety relating to benefit sharing. 44. Reference for recovering benefit sharing under section 26 - Incaseofdefaultorfailure onthepartofthebreederofthevarietyto deposit the amount ofbenefit sharing in the Gene Fund, as per the Order ofthe Authority of section 26, required under sub-section(6) within a period of three months from the date of such order, the Registrat shall make a reference to the District Magistrate under subsection (7) ofthat section 26 in Form 0-4 ofthe Third Schedule. Afiplieation for registration of title of agent or licensee under section 28 - (1) An application under sub-section (4) of section 28 for registration as an agent or licensee, as the case may he, shall be made in Form PV-9 of the First Schedule. 5 (2) The application for title by a licensee or an agent shall be accompanied by three attested copies of the agreement or instrument 'of entitlement or any other documentary evidence. (3) The proposed agent or licensee may also be required to produce such other documents and information as may be required by the Registrar in ' support ofthe proofof title. (4) The applicant under sub-section (4) of section 28 shall pay the fee as specified for the purpose in column (3) ofthe Second Schedule. Reference of disputes of entitlement under section 28 - (1) While refitrring a dispute under sub-section (4) of section 28 to the ' Authority for determination the Registrar shall furnish all the relevant information reiated to dispute with three copies of all the documents and evidence available with hisofl‘ice. (2) On receipt of an order of the Authority in respect of the dispute, the Registrar shall fitrnish copies of the order to the persons involved for necessary compliance. Certificate of registration of entitlement under section 28 — The certificate of registration to be issued to a registered iicensee or an agent by the Registrar under sub—section (4) of section 28 shall be in Form 0- 5 of the Third Schedule. Application and procedure for varying or cancelling terms of registration under section 28 - (I) An application under clauses (a), (b), (c), (d), or (e) of sub-section (9) of section 28 for variation or cancellation of the terms of registration of a registered breeder or his successor or a'ny other personshall be iii Form PV-10 of the First Schedule. {2) Every applications under sub—rule (1) shall be aecompanied by a fee as specified for the purpose in column (3) ofthe Second Schedule. Notice and proceedings under section 28 - ( l.) The Registrar shall issue notice ofevery application under sub-section (10) of section 28 in Form 0- 6 of the Third Schedule to the registered breeder or the agent or the licensee (2) Any person to whom a notice has been issued under sub-rule (1) and who intends to oppose or intervene in any proceedings under section 28, shall, within three months of the receipt of such notice, give notice of opposition or intervention to the Registrar in Form PV-ll ofthe First Schedule. (3) On receipt of a notice of opposition or intervention the Registrar shall furnish a copy of it to the applicant. (4) The Registrar may accept or refiise the application or accept it subject to any condition, modification or limitation as directed by the Authority and shall inform the parties in writing accordingly. CHAPTER V SURRENDER AND REVOCATION 0F CERTIFICATE OF REGISTRATION ‘3 AND RECTIFICATION AND CORRECTION OF REGISTER 50. Surrender of certificate of registration under section 33 - The registered breedewmay at any time, by giving notice to the Registrar offer to surrender his certificate of registration of plant variety in Form PV-lz ofthe First Schedule, under sub-section (1) of section 33. 51. Procedure on application for surrender of certificate of registration under section 33 - (1) The Registrar shall give notice in Form 0-7 of the Third Schedule, every notice of offer made under rule 50 to the registered agent or the licensee relating to such certificate. (2) (a) Any person who has been given a notice of surrender of ceitificate of registration under sub-rule (1), who intends to oppose the surrender, shall within three month of the receipt of such notice, give notice of opposition to the Registrar in Form PV-l3 of the First Schedule. and shall send therewith a written statement setting out the nature of the opponents” interest, the facts relied upon along with the notice of_ opposition. (b) The Registrar shall thereupon serve the notice of opposition along with - the written statement received by him to the applicant. (3) 1f the applicant desires to contest the opposition, he shall file or leave at the appropriate office a reply statement setting out fiilly the grounds upon which the opposition is contested, within a period of three month fi'om the date of receipt of the copy of _the written statement by him under sub-rule (2) and deliver to the opponent a copy thereof. (4) The applicant or any person to whom a notice under sub-rule (1) has been issued may, make an application to the Registrar in Form PV—l4 of the First Schedule, for seeking an opportunity ofbeing heard. (5)0n receipt of an application, under sub-rule(4), the Registtar may fix the time and place of hearing and issue notice to the patties accordingly and the‘interested parties may appear and give or file evidence in support of their case. (6) The Registrar may accept or refuse the application or accept it subject to any condition, amendments, modifichtions or limitations and shall; accordingly, inform the parties in writing. (7} If the Registrar accepts the registered breeder’s offer of surrender of the plant variety, he shall by order direct the registered breeder to return the certificate of registration and on receipt of such certificate, the Registrar shall, by order, notify the surrender in the Official Gazette. Application for revocation of protection granted to a breeder under section 34 - Any person may make an application to the Authority in Form PV-15 of the First Sehedule, for revocation of protection granted to a breeder in respect of a variety on any ofthe grounds laid down under ciauses (a) to (h) of section 34. Pmcedure on application for revocation under rule 52 - (l) The Authority shall issue notice in Form 0-8 of the Third Schedule, to the registered breeder ofany application received by it under rule 52. (2) (a) In case the registered breeder intends to oppose the apptication for revocation ef protection, he shalt, within three months from the date of receipt of such notice, give notice of opposition to the Authority'in- Form PV-16 ofthe First Schedule, and shall send therewith a written statement, Setting out the facts upen‘iwhich he bases his case and the reiief sought. (b) The Registrar shall serVe the notiCe of opposition along with the writteh 1 Statement received by him to the applicant. (3) If the applicant desires to contest the opposition, he shall file or leave at the appmpriate office, a reply setting out the grount‘s upgn whieh the opposition is cemes'ted, within a period of three months fiqm the date of receipt of the copy of the Written statement by him under sub-‘fiile (2) and deiiver to the opponent a com! thereof. 7 (4) (a) The applicant and the regixii'aed breeder may make an application to the Registrar in Form PV-lir' 5 1h: i‘irSt Schedule, ‘ seeking an npgftunity ofbeing heard (b) The Registrar may. on teeth .‘i‘ :="-'-?‘. :mpliuticn; fix such time and place for hearing and issue notice It) the. Pattie; ZCC’H‘flUeg and the interested parties may appear and give or file evidcniee h: support of his case. (c) The Registrar may. accept or rat se the application or accept it suhjesit to any condition, amendments, nh-Jilieattons or limitations and shah. accordingly inform the parties in writing. (5) [f the Authority aceepts the application for revocation of thevplant variety, it may direct, by order, the registered breeder to return the certificate hf registmtion and on receipt ofsuch a certificate, the Registrar shall by order notify the revocation ofthe plant variety in the Ofiieial Gazette. 54. Payment of annual fee for retention of régistration under section 35 - The registered breeder, agent and licensee shall pay an annual fee for retention of registtation at such rate as specified for the purpose in column (3) ofthe Second Schedule. 55. Application for cancellation or change of certificate of registration under section 36 - (1) Any person may make an application for changing the certificate of registration on the grounds laid down under sub-section (1) of section 36 t0 the Registrar. (2) Every application under sub-rule (1) shall he made in Form PV-18 of the First Schedule and shall be accompanied by astatement of the grounds on which it is made. 56. Procedure on application for cancellation or change of certificate of registration under section 36 - The Registrar may accept or refiise the application or accept it subject to any condition, amendment, modification or limitation as he may think fit to impose and shall inform the concerned patties in writing accordingly : Provided that no application shall be rejected unless the applihant has been given a reasonable opportunity to make a representation against such rejection. 57. Application to rectify the register under section 36 - Any person may make an application to the Registrat, in Form PV-19 01' the First Schedule, stating the grounds on which it is made, for making expunging or varying the entry 0n the grounds laid down under sub esection {2) ofsection 36. 58. Precedure on application to rectify the Register under rule 57 - The Registrar may accept or refuse the application for making, expunging o? varying the entry or accept it subject to any condition. amendment, modification or limitation as he may think fit to impose and shall inform the rencerned parties in writing accordingly : Provided that no appiieation shall be rejected unless the applicant has av . been givenfleasonable opportunity to make a representation against such rejection. Cancellation or change of registration or rectification of the Register by the Registrar under section 36 ~ (1) The Registrar while exercising the powers under sub—section (4) of section 36 to cancel the registration, may make changes to the registration, or in case of rectification of the register, shall give notice in Form 0—9 of the Third Schedule to the mgistered breeder, agent or licensee, if any, and to any other person who appears to the Registrar to haVe any interest in the plant variety, and shall state the grounds on which the Registrar intends to take any action. "(2) If any person who has been given a notice under sub—nile (1) intends to oppose the action of the Registrant, he shall within three month from the date of the receipt of such notice, give the notice of opposition to the Registrar in Form PV-20 ofthe First Schedule, and shall send therewith a written statement setting out the facts upon which he bases his case and the relief sought for. (3) The Registrar afier hearing the person to whOm a notice under sub-rule (1) has been given may pass such order as he may think fit and shall, accordingly, inform the parties in writing. Application for correction of Register by the registered breeder under section 37 - An application for correction of the Register may be made by the registered breeder of the plant variety to the Registrar under sub—section (1} of section 37 in Form PV-21 of the First Schedule, for making any change as laid down in clauses (a) to (c) of subsection (1} ofthat section 132 THE GAZETI'E OF INDIA : EX'I'RAORRHQARY . {PART 11—85:; 3(1)] 614. Procedure on application for correction of the Register under rule 60 - The Registrar may accept or refixse the application made finder rule 60 for cenection of reg'mter or accept it subject to any condition, amendments, modifications or limitations as he may think fit and shalt; accordingly, inform the parties in writing. 62L Apphcatiun for correction of the Register by the registered agent or [ieeneee under section 3” - An application for correction ofthe Register may also be mde by the registered agent or the licensee to the Registrar under sub-section (2) of section 37' in Form PV-22 of the First Schedule on the grounds laid down in suh—seetion (3) of that section. 63;. E’meedure 0n applic‘ation for correction of the Register under rule 62 - (3) The Registrar shall issue notice ofevery ‘appiication under rule 62 in Form 0 “190‘?th Third Schedule, to the registered breeder. ('1) The Registrar may accept or refine the application or accept it subject to any cendition. amendment, modification or limitation he may think fit and shall, aecerdingly, inform the parties in writing, provided that tests rei'errcd to in subsection (3) of section 23 shall be conducted by the Authority in consultation with the Central GOVernment : Provided that no application shall be rejected unless the applicant has EL .tween givenlreasonable opportunity to make a representation against such rejection (:4. Attention of denomination of a registered variety under section 38 - {E} Ar. application, to delete any part or to mid qr to alter the denomination of 2: registered variety, under subsection (1) of section 38, shall be made by the ?“greeder t0 the Registrar in Form PV-23 0f the {‘11-‘51 Sch. 'tuh; (2) The Registrar may determine whether and subject to what conditions, if _ any, the amendments shall be allowed. (3) (a) The Registrar shall advertise the application for alteration in denomination in the Gazette or : journal or a daily rxewzspaper and shall also advertise the nature of the proposed alteration in the denomination (b) The Registrar shall issue notice to all the persons, who, in his opinion, may have an interest in the matter. 65. t'roeedure on application for alteration of denomination under rule 64 - (1) Any interested person may, within three months from the date of advertisement of an application for alteration in denomination of a registered variety, under sub-section (2) of section 38, give a notice of Opposition to the proposed change in denomination of a registered variety in Form PV -24 ofthe First Schedule. (2) The Registrar shall serve a notice to the breeder, about the opposition received for the proposed change in denomination _and shall give an opportunity to both ‘the parties of being heard, if so desired, before deciding the Hatter. (3) In the event of leave being granted for alteration of denomination, the denomination as so attered shall be advertised in Gazette or a journal or a daily newspaper in Form 0-11 ofthe Third Schedule. I369 b7. THE GAZETTE OF TNDIA : EXTRAORDINARY [PART H—SEC. 3Q] CHAPTER VI FARMERS’ RIGHTS (?laim for compensation under section 39- (t) Any t‘armert group of fanners or the organisation of the farmers may make an application, under sub-section (2) of section 39, to the Authority to claam compensation. (2) Every application under sub-rule (1) shall be in Form PV-25 of the First Schedule. Procedure on application for claim for compensation under rule 66 — (l) The Authority shall give notice to the registered breeder about the Compensation claim received in respect ofthe registered variety. Q; After receiving a notice from the Authority under sub-rule (1), the registered breeder may, within three months from the date of receipt of such notice, file notice of opposition in Form PV-26 of the First Schedule. {(3) ”in the eventuality of the breeder faéling or defaulting to tender his opposition, within a period of three months, from the date of receipt of the notice for compensation, it shall be presumed that he has no opposition to such claim and accordingly such claim shall be decided. {fly The Authority shall, upon receiving opposition from the breeder give opportunity to both the parties of being heard and may direct the breeder to pay such compensation to the farmer, the group of farmers or the organisation of the farmers, as the case may be as it deems fit.. 68. Issue of notice under section 41 - (1) On receiving the report from the centre notified under sub-section (1) of section 41, in respect ofclaims filed by a person or group ofpersons or gevemmental or non-govemmenta! organisation, for compensation to the peopte of any village or local community for their contribution in the development of new variety, and if satisfied, the Authority may issue notice to the registered breeder or his assignee or registered agent in Form 0-12 ofthe Third Schedule. (2) Upon receiving the notice fiom the Authority, the registered breeder or his assignee or registered agent may file objection to the claim for compensation within three months in Form PV—Z‘T ofthe First Schedule. (3) The Authority, upon receiving objection from the registered breeder or his assignee or registered agent, shall give opportunity of being heard to both the parties and’ after deciding on the eligibility for and quantum of compensation shall, direct, the breeder to pay compensationto the person, the group of persons or governmental or non- governmental organisation which has made the claim under sub—section (1) of section 41 and deposit the requisite fimds withm a period oftwo months with the Gene Fund . 69. Manner of receiving benefit sharing under section 45 - The breeder of a variety or essentially derived variety shall deposit the amount of benefit sharing, as required under sub—section (6) of section 26, with the Gene Fund. 70. Manner of applying the Gene Fund under section 45: - (1) The Authority shall pay the amount of benefit sharing, compensation required for use of genetic material towards evolution of new and essentially derived variety, to meet expenditure incurred for conservation and sustainable use of genetic resources and for the framing of schemes related to benefit sharing. {t 122;.t :eneFund shall be applied for meeting the following purposes in aemntaztze with thepriority made hereunder :- (a) to support and reward farmers, community of firmers, particularly the tribal and rural communities engaged in conservation, improvement and preservation ofgenetic resources ofeconomic plahts and their Wild relatives, particularly in areas identified as agro-biodiversity hot spots; (b) for capacity buiiding on ex'situ conservation at the level of the local body, particularly in regions identified as agro-biodivehsity hot spots. and for supporting in~situ conservation; (c) on benefit sharing and compensation in accordance with sub-section (5) of section 26 and sub-section (3) ofsection 41; and (d) on transaction cost ofadministering the Gene Fund. CHAPTER VII 71. Compulsory licensing under section 47 - (1) Any interested person may, after the expiry of three years from the date of issuance of a certificate of registration of ? variety make an application to me Atithority, m the Chm PV-ah of the First Schedule along with the fee specified under the Second Schedule under sub-section (1) of section 47 for grant ofcompulsory license. (2) The application for compulsory license under sub-section (1) shall - (a) specifies particulars of variety denomination, generic and specific name of the variety or varieties concerned, (b) contain the grounds for issue of compulsory heense with supporting documents, and (c) be suppotted by - i) qualification, technical and financial capabilities of the person making such request with evidence, ii) particulars ofthe holder ofthe right to the variety, iii) written evi-teer-e that the pfi'ASUKI, rmking such .wuesr, has exhauswa ah measures for voluntary license. (3) If afier considering the application under sub-rule (1), the Authority is satisfied that a prima facie case has not been made for grant of compulsory license, it shall notifyvthe applicant accordingly. (4) On receipt of an application for grant of compulsory license under sub- rule(l), the Authority shall serve notice to the breeder of such variety or his assignee or registered agent inviting his opposition within one momh from the receipt ofsuch notice. (5) On receiving a notice under sub-ru1e(4); the registered breeder or his assignee or registered agent may give notice of opposition in Form PV-29 of the First Schedule, which shall be supported by documentary proof to substantiate the ground or grounds of oppOsition. (6)1f alter giving an opportunity to both the parties of being heard, the Authority is satisfied that there is a need for the grant of compulsory license, he may order the breeder or his assignee or registered agent to license the variety on such terms of royalties anu other remuneration as it may deem fit. Manner ofmaking material available under section 50 - . The Authority shall make available to the licensee of such compulsory license, the reproductive material of the licensed variety from the Gene Bank or any other centre, including the initial breedet of such variety. Revocation of compulsory license under section 52 - 1 (a) Any person in respect of compulsory license aggrieved may, under sub— section (I) of section 52, _make an application in Form PV-30 of the First Schedule to the Authority, for revocation of compulsory license on any of the grounds specified in sub—section ( l) of section 47 or section 52. thin The application under sub-rule( 1), shall be supported by evidence. 'i‘he Authority on its owa motion or on receipt of the application fi'om the aggrieved person under sub—rulefl), may give notice to the iicehseei The licensee may file an opposition to an application under sub-rules {i} 0: a proceeding under sub-rule(2), in Form PV-3] of First Seheaiuie with the Authority, 4: The Authority shalt alter considering the opposition filed under sub- rule (3) and after giving an opportunity to the licensee of being heard passing an order ofrevocation or refuse to grant such order. CHAPTER VIII FINANCE, ACCOUNTS AND AUDIT 74‘, itéastzeisl and administrative powers of the Chairperson under section 63 - t t) ”'1 Ess- tf‘liaitperson shalt exercise such financial and administrative powers over 1111:: ticnctimas 9f the Authority as ate exercisable by a Head of Department {mm the General Financial Rules in accordance with the accounts and thzamxfl rules ofthe Government ofIndia. {2'} "the (?hairperson may, delegate such financial and'administrative powers in writing; as he may deem fit, to a member or any subordinate officer of the .haztlturity not below the rank of a Registrar or equivalent subject to the condition that the member or officer so authorised shall, write exercise such :éeiegated powers continue to be under the direction, control and supervision CHAPTER 1x MISCELLANEOUS 75. Manner of authorising registered agent or registered licensee under section 8i - r (1) A breeder of a variety or it’s propagating material or essentially derived _ variety or it’s propagating material registered under the Act, may make an application under section 81, in Form PV-32 of the First Schedule, for authorising the registered agent or registered licensee or his assignee to institute appropriate proceedings in any court of law on his behalf. (2) Where any authorization has been made under sub—rule (1), the service upon the agent ofany document relating to any proceeding or matter under the Act or these rules shall be presumed to be a service upon the person so authorizing him; and a1! conunurfications directed to be made to a person in respect of any proceeding or matter may be addressed to such agent, and all appearances before the Authority relating thereto may be made by or through Such agent. ‘ * (3) Notwithstanding any thing contained in sub—rules (1) and (2), the Authority may, if it considers necessary, require the signature or presence of an applicant, opponent or party to such proceeding or matter. 76. Manner of issuing certified copy under section 84 - Any interested person may, under section 84, make an application in Form PV-33 of the First Schedule, along with fee specified in the Second Schedule, to the Authority or Registrar for obtaining certified copies of any entry in the Register, certificates or extracts of plant variety application or other records maintained by the Authority and any document required in any proceedings under this Act and pending before such Authority or Registrar; and he may make a request in similar manner and for similar purpose to inspect such entry or document. E-‘iu‘t Schedule ' {See rule 3(1)} Forms Form number Sodium And Rules .1 Tit]: (l) (2) (3) ' PV 1 Seaiion 16(1) (e) and Ru}: 25 Applicatian for amlmti'zation _pv 2 ’ Sectibn 13(3) and Ru 1. :2"? :2; Proofof Right to file Application PV3 Semen 21(2) and Ruiz: 3l Nome ofOppositiou PV 4 Section 21(4) and Ruiz 31 L5) Coumrrr- 5.42%.naemcm ' rv s Scuba 21 and Ruie 33 (L) Request for Extension ofTime PV6 Section 24(6)‘and Rule 39 Renewal ochgistration PV 7 Section 26(2) and Rule 4| Benefit Sharing Application _ PV 8' Section 26(3) and Rule 42 Notice ofOp'position W? in” 7i Sectm 28(9) and Rule 43 Application for VariationICamellation of , ' - ‘ ‘ 3‘ 1 ' ' Notiog of Oppoéition against' , vanat'ion! , PV n . mason)and Rule 49 cancellation afthe tgm decgisuation W 12 Section 33(1)“ Rule 50, Applicatipp to Slm'ender the Certificate ' , of Registration ofa Plant Variety Notice of Opposition for 011131 to I’V 13 Section 33(3) and RuleSl (2) smender the Certificate I’V 14 Section 33(4) and Rule 51(4) Notice ofIntention to attend Hearing PVIS Section 34 and Ru“! 52 Application to Revoke Certificate of Registration I’V16 Saction 34 and Rule 53 Notice of Opposition to application to _ Application for an opportunity of being PV 17 Section 34 and Rule 53(4) heard Application for Cancellation or. Change PV 18 Section 36(1) and Rule 55 of the Certificate of Registration of a Plant Variety Application for correction in National PV 19 Section 36(2) and Rule 57 Plant Variety Register “ ___ Notice of Opposition for Application for PV 20 Section 36(4) and Rule: 59 correction in National Plant Variety Register 1 ' ”WW Application for correction in National PV 2] Section 37(1) and Rule 60 Plant Variety Register by Owner/ Breeder PV 22 Section 37(2) and Rule 62 Application for correction in Naiional . Plant Variety Register by Registered Agent or Licensee PV 23 Section 38(1) and Rule 64 Application to alter Denomination of a Registered Plant Variety m (2) (3) 372LV _m , Notice of Opposition to Application to E V 24? ' Sci :ion 38(2) and Rule 65 Alter Denomination ofa Registered Plant “2 _____ Variety 1? "v’ 25 Section 39(2) and Rule 66 Application for Claiming Compensation ‘1"V26 Section 39(2) and Rule 67(2) Notice of Opposition to Application for Claiming Compensation i“ V27 Section 41(3) and Rule 68 Notice of opposition to application for chiming compensation 13W 28 Section 47(1) and Rule 71(1) Application for grant of compulsory license E“! 29 Section 47(3) and Rule 71(5) Notice of Opposition to an Application ‘ for Grant ofCompulsory License 1 7 Application for Revocation of y 7 3i? i Section 52(1) and Rule 73(1) Compulsory License i , ii ; Notice of Opposition for Applicaiion for r 32 ! Sn‘cikm 53 and Rule 73(3) Revocation ofCompulsory License I *5 ’52 [ E‘aciion 81 and Rule 751) Fonn of Authorization to Institute Suit. E” E Eamon 84 & Rule 75 Request for Certified Copy ,. m. .. ' Secohd Schedule (see rule 8) FEE Serial Fees payable on matters Amount of fee Form number number Dependent on the 1. Conducting Tests nature and'type of - test subject to a maximum of Rs. 50,000/— per entry 3. Extension ofTime Rs. 1500 per month 7 PVS 4. Fees for Registration ofEssentially Individual—SOOO Pcr year 6. Application for Benefit Sharing Rs 5000 PV 7 7. Application for Registering as Agent Rs 10000 PV 9 [Licensee 8. Application for variation! Educational—5000 cancellation of the terms of Cormmrcial—7000 PV 10 Registration 9. Notice 01' Qppositidn to Application 1 Registration Third Schedule Forms To Be Used By Registrar And The Central Government Farm Sections and Rules Title number (M Section,21( 1) and Rule 30 Form ofadvertisement 0-2 chtion 23 (3) and 24(2) and Certificate offegistration 2 2 N “2,71,19,16 36, 37 3 13—3 Section 24(3) and R1112 38 Notice for non completion ofregistration 0- 4 Section 26(7) and Rule 44 Reference to District Magistnte for collection ofbenefit sharing amount 0- 5 Section 7.8 (4) and Rule 47 Certificate of registration as agent] {Mi Section 28(10) and Rule 4?.) 1 Nome to breeder/agcnt/ licensee "m -.. . .._._.... . -.. ”,2, ' - . .-. . .-_. ...J ! 1),? Section 33(2) and Rule 51 To mfiry offer made for wander of registered varieiy {)3 Seciiv-zz ‘3‘: and Rule ‘3 Notice of application for revocation 01 registered varim 01:3 Section 36(4) and Rule 59 Change in NaIEnml Register {1% 1 0 Section 37(2) and Rule 63 Correction in National register 0—1 1 . ?Jecticm 311(2) and R1116 Advertisement of Alteration in Fourth Schedule {See rule 20(1)} s). No meet Po“ 11f posts Equivalent Post under the Central Government Sale of Qualifications and experience Financial Advisur' Director 14,300 — A chree from a recogn'md University or equivalent at least eight years expen'énce in management. Legal Advisor Deputy Secretary An Advocate at least eight years practice as such and having special knbwledge in Intellectuai Properties, Management and Transactions. ' Senior Accounts Officer “Under Secretary A Degree in Commerce from a recognized University or equivalent with at least eight years experience as an Accounts Officer. Accounts Officer Assistant Director A Degree in Commerce or Economics as one of the subject at Degree level fiom a recognized University with at least six , years experience on accounts related matters. Technical Assistant Technical Assistant A Degree in Agricultural Science or allied field like botany or biotechnobgy with at least 4 year experience in plant varietal improwments and seed development activities. Computer Assistant 5.500 9,000 A Degree from a recognized University in Computer Applications and at 1:351 one year experience in Data. BaSe Management. 135“, 7 ,, _ 11 1F. (321251213 OF INDIA ; EXTRAORDINARY [PmHm3(1)] FORM - PV—l {See rule 25} THE PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT, AUTHORIZATION FORM hereby au‘ihonse to act on myfour behalf in, connection with filing of new variety/ essential derived variety/exiant variety in respect of and request 111a! all notices, requisitions and communication relating thereto may be sent to such pes‘son(s) at the above address(es) unless otherwise specified. L/We 1112121)}; revoke all previous authorization, if any made, in respect of same matter 01' pmceedmg, Dated this .......... day of ........../200_ .1 Signature(s) & name of person(s) making this authorisation along with the designation and/or official seal, if any. Tu. The Registrar The Plant Varieties Registry Note :~ No F9? 1.,Hnsert 1119, Name(s) (in full), address(es) and nationality of EM person (3) making this authorization. 2.111.429“: Name(s) (in full), address(es) and nationality of the person(s) authorized. 3. Name (mnmum/botanicalmf the plant variety, and crop. FORM - PV 2 [See rule 27(2)] THE PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT, PROOF OF RIGHT TO MAKE APPLICATION ‘refened to in this applicator) as claiming to be the breeder or plant variety right holder hereby declare that the applicant(s) who has/have signed this application is/are my/our assigneds') 1'51" sueeessefls‘). I/we hereby enclose herewith the foilawing documents as requied under n11e 27(2):— I/we hereby declare that the infomation given above is true and correct to the best of my/our knowledge and belief. Signatures oftwo witnesses along with their flames and address : We also hereby declare that the information given above are true to the best of my/our knowledge and belief. Dated--—-—--this...... .. .. .day of ................................200 . Signature ............................. Note :- Strike out whichever is inapplicable. To The Registrar The Plant Varieties Registry At 1. [used (in fi111) name, address and nationality. 2. To be sighed by the Breeder or true Plant Variety Right holder(s) 148 THE GAZETTE OF iNDIA 2 EXTRAORDINARY _ {PART Il—SBC. 3(1)] FORM - I’V3 [See rule 31(1)] THE PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT, NOTICE OF OPPOSITION I/We1 ............................................. ......,hefeby give notice of‘ Opposition, to the application for rEgistration of plant variety registration No.2 .................... , published on for the folldwifig rea§0n(s) : - Dated this ................ Day of ............... 200 ....... To, The Registrar Piant Varieties Registry 1. Name, address and nationality ofthe person(s) filing notice ofopposition 2. Registration number as advertised 3. Signature of the person(s) filing notice ofopposition I/We hereby declare that the facts and matter stated herein are true to the best of my/our knowledge, information and belief. Dated this ................ Day of .............. 200 ....... (Signature? ..................... To The Registrar The Plant Varieties Registry At Strike out whichever is inapplicable 1. State the name(in full), address and nationality. 2. To be signed by the Applicant(s) FORM - PV 4 [See rule 31(5)] THE PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT, FORM OF COUNTER-STATEMENT In the matter of opposition to the application No........ for the registration of a plant variety having registration No......... , published on ..,_ .......... I/We ' ......... the applicant(s) for registration of the above plant variety hereby give notice that the following are the grounds on which I/we rely for my/our counter statement: - I/We admit/ disagree with the following claims/allegations/contentions in the notice of ' opposition ............... 1:50 THE GAZETTE OF INDIA : EXTRAORDNARY Qginfm 3(1)] All communications in relation to these proceedings may be sent to the following address in India. -2 Dated this ........ day of ....... 200. .. To The Registrar The Plant Varieties Registry At ------— No Fee : 1. Insert the Name(s) (in full), address(es) and nationality of the person(s) making this authon'zation. lnsen Name(s) (in fiJll), address(es) end natibnality ofthe person(s) authorised.t o 3. Signature ofthe applicant or his agent or assignee. FORM — PV 5 [See rule 33(6)] THE PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT, REQUEST FOR EXTENSION OF TIME 1/wel hereby request for extension of time for -------- months under rule 33 for filing notice of opposition/evidence/counter statement. In respect of application No------------ . [muwmmn . mam:W 151 The reasons. for making this application is/are as follows:- My/address for service in India is as follows:- Dated this. . . .. ....... day of .......... , 20 Signature: ............................ To The Registrar The Plant Varieties Registry At .......................... 1. Insert the Name (in full), address and nationality of the Applicant. 2. To be signed by the Applicant(s). FORM — PV 6 THE PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT, APPLICATION FOR RENEWAL OF REGISTRATION O I/wel... .. . . .. apply for the renewal of the plant variety registration No. ........ dated .......... in respect ofthe plant variety2 .......... , having denomination . . . . . . 1 gsz 7 T1113 GAZETTE OF INDIA : EXTRAORDINARY [mn—Sm 3(1)] 1‘11»:- antics ot‘renewal ofthe registration may be sent to the f0110wing address in India :- Signatures To The Registrar The Plant Varieties Registry At ........................... 1'. Insert the hill name with surname and address ofthe applicant(s). L Name ofthe registered plant variety FORM - PV 7 [See rule 41(1)] TH E PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT. APPLICATION FOR BENEFIT SHARING I/wei . . .............. , hereby apply that my/our name(s) may be registered as person(s) entitled to benefit sharing in respect ofthe plant variety, registration No. .......... The grounds for my/our being entitled to benefit sharing are given below :- The details oftheplant variety in respect ofwhich I/we am/are claiming benefit sharing are as followszz- Plant Variety, ol’whieh the registration Number is ............ 'And in proof of my/our entitlement to benefit sharing whereof I/we transmit the accompanying documents ................. with a certified copy thereof. Mylour address for service in India 154 Dated this .....t....day of .............. 200........... . ........ To The Registrar The Plant Varieties Registry At ....... ...... 1. State fi111 Name and address as stated in the application for registration. 2. Name (common/botanical) ofthe plant variety and crap. 3. Specify the particiilars of such documents, giving its date, and patties to the same and showing how the c(laim made is substantiated. 4. State the name ofthe place ofthe appropriate office ofthe Plant Variety Registry. 5. Signature ofthe Applicant or ofhis agent or assignee. FORM ,— PV 8 [See rule 42(4)] THE PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT, NOTICE OF OPPOSITION TO AN APPLICATION FOR BENEFIT SHARING [fWel ................... hereby give notice of opposition to the Application for benefit sharing made by/on behalf of2 .......... and in respect of the registered plant variety........, registration No...... dated The grounds on which the said application for benefit sharing is opposed are as follows:— u in support of my/our opposition, I/we hereby enclose herewith copies ofthe following documents :- My/our address of service in 1na1a 1s ...... . ...................................... Dated this .......... day .......... of ....... 200 ..... Signature 3 To The Registrar The Plant Varieties Registry At................... Strike but whichever is inapplicable 1. Insert the name (in full), address and nationality ofthe Applicant 2. The name(s) ofthe person(s) who has filed benefit shan'ng application 3. To be signed by the Applicant(s) FORM - PV 9 (See rule 45(1)) THE PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT, I APPLICATION FOR REGISTRATION AS AN AGENT 0R LICENSEE I/We' ...... . ........ ..._ hereby apply for registrtltion as an agent or licensee under sub—sectian (4)01" section 28 of the Protection of Plant Varieties & Farmers’ Rights Act, 2001. We hereby declare that [/we am/are an authorized agent or licensee in respect of the plant variety2 .................registration No................. and that l/we am/are fillly eligible to be 'a registeted agent or licensee under section 28 of the Protection of Plant Varieties and Farmers Rights Act, 2001 (53 Of 2001) and the rules made therein. Given below is my/our particulars:- _ 1. Name in fitll beginning with surname (in capital letters) .............................. 2. Address ofthe place of residence ................................................................. 3. Father’s Name ..........................................._ ............................................ 4. Nationality ..................................................................................... 'j ..... 5. Date and place of birth ..._ ................ . ......... . ............................................. 6. Oceupation in full .................................................................................. 7. Principal plaeeofbusiness 8. Addmss 9fthe branch office, if any ............................................................. . 9. Documents enc105ed 3 l. 1 i: also hereby declare that the information given above are true to the best of my /our knowledge and belief. thwart)”, . dayof 200 SIGNATUTRE The itegistrar The Plant Varieties Registry At ............... 1 1113611 Name(in full), address and nationality of the persons entitled to benefit sharing. it i)t3111’>111i11311011, variety; registration number and other details of the plant van ieiy( ies) in respect of which benefit sharing is claimed. “a Specify the particulars of such documents, giving its date and parties to the same and shuwing how the claim made is substantiated. 4 E51111 address of the persons) who has/have the claim for benefit sharing. 5) E 1- be signed by the Applicant(s) or authtjrised licensee(s) 0r agent(s) or legal sumessort’s) or assignee(s). . FORM - PV 10 [See rule 48] Til}? PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT, 4t i’l’lJCATION FOR VARIATION/CANCELLATION OF THE TERMS OF REGISTRATION 1. that [We ...... is/are registered breeder (5)/licensee/agent of the plant variety, registration No ....... ; 2. that the registration'of the plant variety was done by an Order of the Registrar 7 dated ...... , 3. that the grounds for variation or cancellation of the terms of registration. are as follows :- l/we hereby declare that the terms and conditions of the registration certificate may be cancelled/revised as follows :~ 1/we hereby declare that the facts and matter stated herein are true to the best of my/our knowledge, information and belief. Datedthis. day of.... .200... Signature 1 To The Registrar The Plant Varieties Registry At ....... 1. Insert Name(in full)‘ address. and nationality. 2 To be signed by the Breeder or true Plant Variety Rights Holder(s). 158 THE GAZETTE OF INDIA ; EXTRAdRDINARY [Pmrnmm 3(1)] FORM - PV 11 (See rule 49) THE PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT, NOTICE OF OPPOSITION TO AN APPLICATION FOR VARIATION 0R I/Wel ................... hereby give notice of opposition to the application for variation/cancellation of the terms of the plant variety registration No...... dated ..for the plant variety.. .., having denomination .. .......... The grounds on which the said application is opposed are as follows: - My/our address of service in India is ............ . ................................ Dated this .......... day .......... of ....... 200. . . .. Signature 2 T0 The Registrar The Plant Varieties Registry At ................. FORM PV-12 [See rule 50] THE PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT, APPLICATION OF OFFER TO SURRENDER THE CERTIFICATE OF REGISTRATION BY THE REGISTERED BREEDER OF THE PLANT VARIETY. In the matter of plant variety .................. , of crop ............ ,having registration No................ registered1n the name of...................... applicationis hereby made by1 We............................. being the [931$qu_pmpflgtgfis)"Qt.“sygeesspucfigfithe certificate of registration in circumstances that are stated fiilly in the accompanying statement. gill communications reiating to this application may be sent at the-following address Dated this ........ date of ....... 20 ........ To The Registrar The Plant Varieties Registry At4........................ Insert the name(s) ofthe person making this application. Address ofthe person making this application. Signature ofthe applicant or its agent. ' State the name of the place of the appropriate office of the Plant Varieties Registry 5. Strike out whichever is not necessary. FORM PV-13‘ -' [See rule 51 (2)] THE PROTECTION OF PLANT VARIETIES AND FARMERS' RIGHTS ACT, N(FI‘ICE OF OPPOSITION FOR OFFER TO SURRENDER 0F CERTIFICATE OF REGISTRATION OF PLANT VARIETY in the matter of application for offer to surrender of certificate of registration, of plant vaiiey .................. , of crop ............ having registration No................. I/We2 ..who is/are the [egisteregfiagent_Q;119e_1_1_sge_ hereby give notice of m)intentiim to eppose the surrender of certificate, notice of which was received by me, daze.J the . . .day of ........ 20 ......... sent by theRegistrar ofPlant Variety. The written statement stating the facts and grounds of opposition are as follows: - All Lemmunications in relation to these proceedings may be sent to the following address in India Dam this day of ............ 20.... T1”) The Register ofPlant Variety The 4:.)in 1)? the Plant Variety Registry at 3 Name 01 the breeder or the successor of the plant variety making an application 2 Name of the opponent making this application. f1 Wtittenstatement setting out the nature of the opponent’ 5 interest the facts upon which ht bases his case and the relief, which he seeks The opponent may fumish ati 111w uments upon which the opponent relies on as annexure to this notice of mm1511 11m .1 Name and address of his principal place ofbusiness or residence ‘ Signaiure of the person making this application for opposition or his agent. (1 State 1111 name of the place of the appropriate office of the Plant Variety Registry. ' .m'ke out whicheveris not HCCCSSEI}. FORM PV—l4 [See rules 51(4)} THE PROTECTIONDFPLANT VARIETIES AND FARMERS’ RIGHTS ACT, - J 21101 . 1110th OF iNTENTION TO ATTEND HEARINGS 111 the 11131111 6111111 applicazttion made under section! ..............- ..... dated ........ day of hereby aidttg 1111. ' 1111111611111 the Registrar to provide an opportunity ofbeing heard in ’réfe'r'enceto the 11501111 matter. 'It is requested that the time and place of the hearing be lacindly intimated to me in the foliowing address The Registrar ofPlant Variety 1. _Insert particulars such as section No, form N6 and also the name of the applicant making an'epplication for mnender. ' 1 Insert name 6fthe person making this natice. Address ofthe person giving this notice. Signature ofperson giving the notice or ofhis agent. , _ State the nameofthe place 61"the apptepria'te office ofthe Plant Van'ety Registry Strike out whichever is not necessary. FORM PV-lS [See rule 52] ‘ P P P P N THE PROTECTION 011 PLANT VARIETIES AND FARMERS’ RIGHTS ACT, APPLICATION FOR REVOCA'I‘ION OF THE CERTIFICATE OF REGISTRATION OF THE PLANT VARIETY REGISTERED ’ UNDER THIS ACT BY ANY- PERSON. In thema'tter of plant vafiety ...... , of crop: ........ having registration No................ registered in the name of ............ 1 .......... appltcauon 1s herezby made ttyl ............................. being the ‘ - of the above mentioned registered plant variety for revocation of the cettificate on one of the following grounds and in circumstances that are stated fizlly 1n the accompanymg - statement. 1. that the grant ofcertificate of registration has been based on in'eerrect information ' furnished by the applicant. v-rk“ ..__ .. THE GAZETTE OF INDIA : EWOBDRJARY 3 _ 3 1.“- Eggn—s-m 391' that the certificate of registration has been granted to a person who is net eligible for protection under this Act. , that the breeder did not provide the Registrar with weh i11t‘o‘ttmthstti documents 111‘ materials as required for registration under this Aet - ‘ that the breeder has failed to provide an alternative denomination of the variety which is the subject matter of the registration to the Registrar 1h cage where'the earlier denomination of such variety provided' 13 theW[h hotjienfiiésihle for registration under this Act , ; that the breeder did not pmvide the necessary seeds 'or propagating material to the person to whom compulsory licence has .been iseqetl 111111111 Whit} 47 re'gatding the variety in respect of which registratteh whats has been issued to shah breeder. ' 1 ' ' 6. That the breeder has not complied with the provisions ofthis Act or rules or regulations rhade thereunder. That the breeder has failed to comply with the directieh of the Authority issued under this Act. - That the grant ofcertificate of registtation is not in the public interest. All communications relating to this applicatiOn- may be sent'a‘t the following address Dated this ........ date of ....... 201 1 . ' To The Plant Varieties Authority/R'egistry At5 . Registry 2. Nature of relationship ofthe applicant with the registered plant variety. S Insert the name of the applicant. Address of the applicant . Signature ofthe applicant or his agent. State the name of the place of the appropriate office of the Plant Van'eties‘ mmrv-te . {lee rule 53(2)] Themum0F9mmVARIETIES AND FARMERS’ RIGHTS ACT, - zoot ' , In the matter at afifiiiéétiafl tet mention of certificate of‘registration by - ‘ " I '1.Wei...........:_:;1;;...;.1..1..whoilthe registeredbreeder, h by give notice of my intention to oppose the revocation of certificate, ofplantvariety plantvariety. ;l'he written statement stating thé‘ {Betti and grounds ofopposition are as follows: - All communications in relation to these proceedingi my be sent to the following address in India. . Datedthis ........dateot ............. 20.... , . . Signatun’........ To . ' . The Registrar ofPlant Variety She Office ofthe Plant Variety Registry at I n Name ofthe peréon making an application for revocationofplant varietyf Name ofthe registered breeder. ‘ I - ‘ 1 ‘ Written statement setting out the nature of the opponent’s interest, the facts upon which he bases his case and the relief, which he seeks. The opponent may fitmish any documents upon which the opponent relies on as annexure to this notice of opposition. . .' Name and address ofhis principal place .ofbusinees or residence Signature ofthe person making this application for opposition or his agent. State the name ofthe place ofthe appropriate office ofthe plant variety registry. FORM PV—l7 [See rules 5301).] THE PROTECTION OF PLANT VARIETIES A_ND FARMERS’ RIGHTS ACT, APPLICAnon FOR AN opponwnm OF BEING HEARD In the matter of the application made under section .................. dated ........day of ‘ making an application to the Registrar to provide an opportunity of being heard in reference to the above matter‘ It is requested that the time and place of'the hearing be kindiy intimated to me in the following address Dated this day of ....... 20 ...... Si t 4 The Registrar of Plant Variety ‘ . The Office of the Plant Variety Registry at ............................................ 1. Insert particulars such as section No., form No. and also the name of the appli cant making an application for revocation Name of the person making this notice. Address ofthe person giving this notice. Signature of person giving the notice or of his agent. State the name of the place of the appropn'ate office of .the Plant Variety Registry 6. Strike out whichever is not necessary. FORM PV-18 [See rule 55(2)] THE PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT, APPLICATION BY ANY PERSON FOR CANCELLATION 0R CHANGE OF ANY TERMS OF REGISTRATION OF THE PLANT VARIETY REGISTERED'UNDER THIS ACT. N V r b In the matter of plant variety .................. , of crop ............ , having Iregistration No ................ registered in the name of ...................... application is hereby made by1 ,, .............. being the registered.breeder.9x.tegi_st§.r.t=d..agettt‘.9t.Legifiteted changethe terms of registration on any of the following grounds and in circumstances that are stated fullyin the accompanying statement. 1. contravention of‘ the provisions of the Act 2 failure to observe a condition subject to which such registration certificate is issued All communications relating to this application may be sent at the following address \.. 00 ........ 'Dated this day of ‘‘‘‘‘ 2 Signature3 ___________ To The Registrar The Plant Varieties Registry At‘ ............................................ T. Insert the name ofthe person making this application. Address ofthe person making this application. Signature ofthe person making tl' is application or his'agent. . State the name of the place of the appropriate office of the Plant Varieties Registry 5. Strike out whichever is not necessary. P P N FORM PV-l9 [See rule 57] THE PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT, , APPLICATION BY ANY PERSON FOR MAKING, EXPUNGINC 0R VARYING THE ENTRY IN THE REGISTER OF PLANT VARIETY In the matter of plant variety ..... -. ............ , of crop ............ , having registration Nous... .......... registered in the name 'of ...................... application is hereby made by1 ............................. being the registered breeder or registered agent or registered licensee or any other person 5 of the above mentioned registered plant variety for making, expunging or varying the entry in the register of plant variety on any of the following grounds and in‘ circumstances that are stated fully in the accompanying statement. 1. absence or omission from the register ofany entry. 2. entry made in the register with sufficient cause. 3. entry wrongly remaining in the register. All communications relating to this appiieation may be sent at the following address2 Datedthis dayi‘of.t.'.... 20..-..." ‘ ‘Siglaturea ............... To The Registrar ' The Plant Varieties Registry ~ At ‘ ............................................ 1. Insert the name ofthe person making this application. 2. Address ofthe person making this application 3. Signature of.the person making this application or his agent.” 4, State the name of the place of the appropriate office of the Plant Varieties Registry 5. Strike out whichever is not necessary. FORM PV-20 [See rule 59 (2)] mt: PROTECTION OF PLANT VARIETIES AND FARMERS” RIGHTS ACT. NOTICE OF OPPOSITION FOR EITHER CANCELLATION 0R CHANGE or i CERTIFICATE OF REGISTRATION OR MAKING, EXPUNGING 0R ' VARYING 'IHE ENTRY IN THE REGISTER OF PLANT VARIETY _ , BY THE REGISTRAR In the matter of the notice received dated .................. fpr' ...................... 1 ...... , by the Registrar of plant variety bearing registration No...... ofcrop. ....... I/We 2 ................ hereby give notice ofmy intention to appose3 .'........I ............ _ The written statement stating the facts and the grmmds ofopposition are as follcmisi: . All communications in relation to these proceedings may be sent to the foiiowing address Dated this day of ....... 20 ........ T0 Signature 5 . .- ............. The Registrar of Plant Van'ety (The Otfice of the Plant Variety Registry at L A . The intention of the Registrar for cancellation or change of certificate 91' registration or making, expunging or varying the entry in- the register 9f piaiit variety. Name of the person making this not1qe ofopp051t10n Written statement setting out the nature of the opponent’ 5 interest the facts upon which he bases his case and the relief, which he seeks. The opponent may fiimish any documents upon which the opponent relies 911 as annexure to this notice of opposnion. Address of the opponent. Signature of the person giving notice or of his agent. State the name of the place ofthe appropriate office of the Plant Variety Registiy, mm. .. (i FORM PV-ZI [See rule 60] THE PROTECTION OF PLANTVARIETIES‘AND FARMERS? RIGHTSzACT, APPLICATION FOR CORRECTION OF REGISTERBY THE REGISTERED ‘ " BREEDER. ‘ In 111.8 matter of plant variety .................. , of crop. .. . ... ..... , having registration No. , , ....... regiitered in my name ie' ...................... application is hereby made by me for making correction to the register of plant variety on any of the following 1.. Correct any error in the Register in the name, address or description bf such breeder or any entry relating to such variety. 2., .E‘nt‘ernin the-Register any change in the name, address or description of such breeder. 3. Cancel the entry in the Register ofthe variety in respect ofwhich such application is made; and may make anyconsequential amendments or alteration in the ‘ certificate of regiStration and for that purpose retitiires the certificate of registration to be produced to him. 2All communications relating to this application may be seht at the following address Dated this day of ....... 20........ T9 The Registrar 'The P_lant Varieties Registry At 4._....,,...‘, ................................. 1. Insert the name ofthe person making this application (registered breeder). ‘2. 'Address ofthe person making this application (registered breeder). 3. Signature ofthe registered breeder or its agent. ' ' 4. State the name of the place of the appropriate office of the Plant Varieties Registry 1.— put... FORM PV-22 ‘ISee rule 62! THE PROIE(.TION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT APPLICATION FOR CORRECTION OF REGISTER BY THE REGISTERED AGENT OR THE REGISTERED LICENSEE 1n the matter 01 plant variety ................. , of crop. ,having registration No ..... .. registered111 the name of ......................application15 hereby made by' .. ,1 . . being the registered licensee/ registered agent of the above mentioned registered plant variety to make correction on any of the following grounds andin circumstances that are stated filliy in the accompanying statement 1. correct any error. 2. enter any change, in the name, address or description of the registered agent. 3. enter any change, in the name, address or description of the registered licensee. 5111 communications relating to this application may be sent atthe following address Datedthis.,.. . dayof ....... 20 ........ Signature " ............... T1) The Registrar The Plant Varieties Registry At5 .......................................... I. insert the name of the person making this application. 2. Reasons of making this application ige. either to correct any error or enter any change, in the name, address or description of the applicant. 3. Address of the person making this application. 4. Signature of the applicant. 5. State the name of the place of the appropriate office of the Plant Varieties Registry 6, Strike out whicheveris not applicable. FORM. . rv-zs 1s” rule 1.621 THE PROTECTION OF PLANT VARIETIES ANDFARMERS’ RIGHTS ACT, ALTERATION OF DENOMINATION l I/ We here by request to add/deletelalter the denomination ofa registered variety-,--—.—-------- , ofcrop-~:---—‘-—-,having registration No----'—¢------;-----—-,pub1ished on------------- . - The existing denomination is-----—------—-—. The denomination when altered will appear _ All notices, requisitions and communication relating thereto may be sent to the fellowias address: ‘ Dated this------—--—--day of -----20—-. T0, The Beginner The Plant Varieties Registry A1-:92-"9'2!-‘--‘-:129-!--2"2--:: §t1'iite off whichevg is inapp‘ligable 1.. Insert the Name(s) (in full), address (es) and Nationality of the breeder/his legal 2_. Signature and Name of the person(s), with official seal, if‘any, making this application. FORM ,— PV 24 [See metal)! THE PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT, NOTICE OF OPPDSITION TO THE ALTERATION IN DENOMINATION hereby give notice of opposition, to the proposed change in the denomination of registered plant variety of the crop .. 4 - having registration No.2 ........................ , published on ............ fit; the following . L’we enclose the following evidence(s) to substantiate my/our statement. Dated this ................ day of ............... 20....... Signature: To, The Registrar Plant Varieties Registry At.............. 1. Name, address and nationality ofthe person(s) filing notice ofogpositien 2. Registration number as advertised 3. Signature and Name, with official seal, if any, of the person(s) filing Notice of Opposition ‘ [Scenic “(1)1 MWWOFHANTVAHETIESANDFAMSRIGHTSACIB _APPIJCATION FORCOMPENSATION l 11W: her ,hyrequestthatlfwemaybeeompensatedinrespectoffl ieplantvanety of the cm}: , having registration No and amassem , forfailure ofmomma matefial to petform asparstipglatgflexpectation iinder given conditions In stippett ofmyleur entitlement t9 enmpensation, I/we are enclosing the follpwtng Myles Address fer service is Dated this ..........day oil..........-........ 211 ............_ Signature 3 The Astl' ”flu: Brgtpetplgn 9!Plant Varieties anti Farmei-s’ Rights . t Insgtt name(iii hill), address aqgnat19nalityof persons making request for ' compensatipn ° §peeify the patticulars ofevidences sho'wing how the claim made is substantiated. U ) . To be signed by the Applicant(s) along with the name(s), and ofiieial seal, if any. FORM 4- PV—26 [See rule 67(2)] THE PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT, NOTICE OF OPPOSITION TO AN APPLICATION FOR COMPENSATION give notice of opposition to the application for compensation made by/on behalf fin reSpect of the registered plant variety ' of crop registration No dated Wis The grounds on which the said application for compensation is opposed are as follows:- In support of my/our opposition, I/we hereby enclose herewith certified copies ofthe following documents:- I. My/our address of service in India is To Signature 3--------------i .- The Authority The Protection ofPlant Varieties and Farmers’ Rights mu. .. FORM — rv.27 [See rule 68(2)] THE PROTECTION OFPLANT VARIETIES AND FARMERS’ RIGHTS ACT, - ' 2001 t NOTICE OF OPPOSITION TO AN APILICATION FOR COMPENSATION I/We ' hereby give notice of Oppositien to the application for compensation made by/on behalf ' 0‘ T in respect of the registered plant variety. of crop _ ' having registration No . dated ._ ' The grounds on whitathe said application for eompensgtion is opposed are as follows:- In support of my/our opposition, [/we hereby encloseherewith certified copies. ofthe following documents:- My/our address of service in India is . Dated this ......... day .......... of ....... 20. . ., ,To The' Authority The Protection of Plant Varieties and Farmers’ Rights Strike ofi'whichever is inapplicable 1.1nsert the name(in fitll), address and nationaiity ofthe Applicant . . 2.The Nanie(s) .of the person(s) who has filed an applicatiou fbr compensation 3.To be signed by the Applicant(s) - I 174 ' 1113 GAZETTE OFJNDIA : EXTRAORDINARY [PtaIII—Sigggj FORM - 1’an [See rule7l(l)] THE PROTECTION OF PLANT VARIETIESAND FARMERS’ RIGHTS-ACT, Grant of Compulsory License I/We', ,. ,. . ‘ . hereby apply for the grant ofcompulsory license fist plant varietyea - —-—",of ‘ ------'2 having registration No— - ' ,published on . on . ' following grounds, namely: - _ l. the reasonable requirements of the public for seeds or other propagating mateial ofthe variety have not been satisfied, 4_ _ .2. the mds or propagating matedal of the variety not W10 to the public at reasonable price. The documentary evidence in support of my/our interest and the hats stated shave and copies thereofare herewith enclosed: - l.’.................................... I/We declarethatthefactsandmattersstatndhereinaretmetothebedefmyibut knowledge, information and belief. _ My/Our address for service in India is ..................................................... Datedthis ................dayof ...........20...... Sigma 2 ................. . To The Authority Protection of Plant Varieties and Farmers’ Rights 1. State the name (in fiill), address and nationality ofthe Applicant(s). 2. To be signed by applicant(s) or if the applicant(s) is/are absent firom India byauthorised patent agent. FORM —No” [See mam); . THE rROTECTION OF PLANT VARIETIES AND FARMERS’RIGHTS ACT, NOTICE or OPPOSITION TO AN APPLICATION FOR, commavumsn: L'Wel herd); give notice ofopposition to the application for compulsory license made bylon behalf 0 of the registered plant variety of crop , having registration No . ‘. _. dated , The grounds on which the said application for oompensatioh is opposed are as follows:- In support ofmy/our oppOSitm Ilwe hereby enclose herewith oertifietl Copies ofthe following documents:- . 3‘ ..-_tfi..-.....-_..___--_-_.... My/our address ofservice in India is Datedthts ......... day .......... of..:....20.... Slgnature To The Authority The Protection of Plant Varieties and Farmers’ Rights Strike off whichever is inapplicable Insert the name(in fufl)‘; idaheseand nationality ofthe applicant 2. The Name(s) ofthe person(s) who has filed an application for oompulsom ~ license 3. To be signed by the epplicant(s) m3 GAZETTE OF INDIA _: EXTRAORDINARY [PmII—Sau 36)] FORM _ W30 - [See rule 73(1)] THE PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT, AN APPLICATION FOR REVOCATION 0F COMPULSORYLICENSE request for revocation Ofcompulsmy license gamed ‘02 f ‘ ' ' 7 ‘ ‘ ‘ V V 7 ‘--- in respect of plant variety-------—----——-—-—-,' ofcrop—«m-fla-ujmving registration No - m----—---—,dated—-----—-,for the following reasons: 1 Violation of terms and conditions of compulsory license , 2. Inappropriate to continue license in public interest ' . The cenified copies of all the documents are enclosed here with in suppert of myto'ur grounds for revocation, I/We deciare that the facts and matters stated herein are true to the best of my/our knowledge information and belief. My/Our address for service in India15 Dated this ......... day .......... of ....... 20, . .. Signature T0 The Authority The Protection of Plant Varieties and Farmers’ Rights Strike off whichever is inapplicable 1. Insert the name(in fun), address and nationality ofthe applicant 2. The Name(s), address and nationality ofthe person(s), who has been granted compulsory license 3. To be signed by the applicant(s) FORM - PV-31 [See rule73(3)] THE PROTECTION OF PLANT VARIETIES.AND FARMERS’ RIGHTS ACT, NOTICE OF OPPOSITION TO AN APPLICATION FOR REVOCATION I/Wc’ -- ' hereby give notice of opposition to the applicgution for revocation [or grant of compulsory licenle made bylon behalf of" in respect of the registered plant variety of crop , having registration No dated The grounds on which the said application for the revocation ofgrant ofcompulsory license is opposed are as foltowsz- ' ' In support of my/our opposition, I/we hereby enclose herewith cenified copies ofthe foilowing documents:- My/our address ofservice in India is ‘ Dated this ......... day .......... of ....... 20.... Signature 3............................ 2339 GI2003—1 2 To The Authority The Protection of Plant Varieties and Farmeu’ Right! Strike offwhichever is inapplicable 11an the name(in full), address and nationality ofthe upplicantllicensee 2.The Name(s) ofthe person(s) who has filed an application for revocation 3.To be signed by the applicanfls) FORM — Pv-‘sz - [See rule 75(1)] THE PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT, FORM OF AUTHORISATION TO INSTITUTE SUIT In the matter of plant variety , of crop , having registration No- - , published on ———-—-, 1 hereby authorize2 ' ‘0 act on my/our behalf in connection with3 I and _ request that all notices, requisitions and communications relating thereto may be sent to such agent/licensee at the ab0ve address. We hereby revoke all previous authodzations, ifmy made, in respect ofthe same matter or proceedings. Dated this ......... day .......... of ....... 20.... (Name and ofl'lcinl seal ifany) I..——'.———. To The Registrar The Plant Variant Registry Strike offwhichever is inapplicable . Insert the Name (in full), address and nationality ofthe applicant 2. Insert the Name (in full),- address and nationality ofthe registemd 3, State the particular matter or proceeding foi- which the authorization has been given ‘ 4. Ta be signed by the applicant(s) [See' mle 76] THE PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS ACT, REQUEST F93. CERTIFIED CQHES .01" ENTRIES 1N THE PLANT VARIETIES REGISTER OR FOR INSPECTION OF SHCH ENTRY In the matter of plant mIety—.-ofcrop—. having registration No- ‘ . , published on—-, We? hereby request you to fitmish melus with a certified copy of V and to land the certified copy an address given above. We hereby request'you to allow me/us to inspect entries/document.................... in respect ofthe above plant variety. 7 The purpose for which the certifiEd copy ofthe entry (iesydocument is fequired is as follows:- Signaturezwm;.............. (Name and official seal if any) To 1) The Registrar The Plant Varieties Registry 2) The Authority Plant Varieties and Farmers’ Rights Authority Strike off whichever is inapplicable 1. Insert the Name (in full), address and nationality ofthe applicant 2. Signature ofthe applicant 3. State the paniculax matter or proceeding for which the authorization has been given 4. To be signed by the applicant(s) FORM 0— 1 [See rule 30] GOVERNEMNT OF INDIA, PLANT VAREITIES REGISTRY ADVERTISEMENT OF ACCEPTED APPLICATION FOR REGISTRATION Application no.-----------filed on by1 or on behalf of M2. for new plant vaIiety/ extant variety/fanners, variety essentially derivgfi variety-------------------—, of crop-----—-—, having denomination;------------,the specification including its, drawing and or photograph(s) of which are given below, has been accepted and given registration number—--------—--on--------- The convention application no.-------~-«,in respect ofthe said variety has been filed on——————————— ,in3-—--------. Appropriate office for the opposition of - proceeding under rule 29, of the Protection of Plant VaIieties and Farmers’ Rights, 2003, Rules is 4------—-----. [umu—uue 3(1)] . fil't'd mama; : Wfit’q . 131 1. Name (in full), address/service address (with registration humber, if ' . applicable) & and nationality ofthe appiicant. 6. Name (in full), address and nationality ofthe breeder (in case applicant is not the breeder) 7. Name ofthe convention country 8. Name ofthe Ofiice. FORM 0-2 [See rules 36 and 37] GOVERNMENT OF INDIA, PLANT VARIETY REGISTRY CERTIFICATE OF REGISTRATION REGISTRATION N0.—-———— OF 200— ' Whereas ................ ............ has declared that he has deveioped ---—---~—-—— plant vaiiety/essentiaily derived plant variety and that he is the true breeder thereof(or ‘ 1 the legal representative or assignee of the true breeder) and that he is entitled to a plant variety right on the said variety, having regard to the provisions ofthe Protection ofPlant Varieties and Farmer’s Right Act, 2001 and that thereis no objection to the registration ofplant varietyinfavour ofhtm And whereas he has, by an application, requested that registration of plant variety/essentially derived plant variety may 'be allowed to him for the said plant Vafiety; E And whereas he he, by and in'his application, particularly described the various distinctive features and mentioned the denomination ofthe said plant variety; Now, these presents that the above seid applicant (including his legal representatives ‘ ' j A and assignees or any ofthem) shall, subject to the provisions offlle Protection ofPlant .‘ltoqlanlm .. l3 Varieties and Farmers Rights Act, 2001 and the conditions specified in section 47 of the said Act, and to the conditions and provisions specified by any other law for the time being in force, have the exclusive right to produce, sell, market, distribute, import or export the variety for a tetm of—years ii'om the .......... day of ...... , the validity of this registration is not guaranteed and that the fee prescribed for the continuance ofthis registration are duly paid. In witness thereof, the Registrar has caused this 'regismtion to be sealed as of the Seal ‘ and Signature of the - Registrar, Plant Varieties Registry Date ofGrant Note: - The fees for maintenance of this registration, if it is to be maintained, will fall due on ....................day of ...................and on the sameday in every year thereafier. FORM 0-3 [See rule 38] GOVERNMENT OF lNDIA, PLANT VARIETIES REGISTRY NOTICE OF NON-COMPLETION 0F REGISTRATION Application No...... ..............dated..... ...... Notice is hereby given under rule 38 ofthe Protection ofPlant Varieties and Farmers Rights Rules, 2003 that the regimhfion of the plant variety, in re3pect .of which- application was made on the ...... day of 200--1-—-,has not been completed by reason of defaiilt en the pint oftheflew The applieant is directed to cohipIete the fellewhig teqtiiremamm ththih I period of 30 days from the date ofthe receipt of this Noticei= Omega]! the ebflve requirements are met within thirty days of the receipt of this notieéf'iiie tpptiution shall be trams as abandoned, SEAL AND SIGNATUTRE OF THE REGISTRAR PLANT VARIETIES REGISTRY [Sunkfll GOVERNMENT OF INDIA, PROTECTION OFPLANT VARIETRIES AND FARMERS RIGHTS AUTHORITY - REFERENCE FOR RECOVERY OF BENEFIT SHARINGAMOUNT I To Reference Case No....‘................ Whereas ........................... hss/have been asked vide Order dated...... to deposit an amount 70f Rs.................... as Benefit Shaiing amount, detennined by this Authoiity vide the same Order issued in respect ofbenefit sharing application No. ....;,with the Natiohel Gene Fund under the pmvisiohs [of Section 26(6). hns/hiwe defaulted or failed to deposit the said i u v e1 184 THE GAZETTE o:IND__IAhEXIEAORDrhARY . . [PmHa:3(1)} benefit sharing amount for the last .......... and where“ the said persuh(s) reside(s)/canies on his/their work at-en-n-«-, which is within your inrisdictian; In view of the above-mentioned default on the part of the person(s) named herein, a reference is being made herein to 5mm office to collect the above mentieheti imbunt of benefit sharing as an arrest of land revenue under the fitovisions of the The amount realised as an arrear of land I’WGQUEQ fiutfitti‘iiit to this i'e‘ " required to be deposited with the National Gene Fund established under the ?mtection ofPlant Vatieties and Farmers’ Rights Act, 2001 within it pbtititi bfthi‘ee tntiflths afié’l‘ realization ofthe said amount. e Dated this ..... day of ...... 20 SIGNATURE WITHSEAL OF THE AUTHORITY FORM 0-5 [See'nile 41] GOVERNMENT OF INDIA THE REGISTRAR OF PLANT VANETIES CERTIFICATE OF REGISTRATION OF AGENT OR IJCENCEE NO................. This is to ceniry that swshim‘s............ . Rlo.. f .......... has/have been registered as an agent/licenSee in respect ofplant verlétfliéi) ' ' ' :0me 1 registration No......... on this ..... . .; . .... day of ........ 200... This Certificate shall, however, be subja'tt te the terms and conditions stipulated in the contract in respect ofthe above mentioned registered plant variety (ies). SEAL AND SIGNATURE OF THE REGISTRAR PLANT VARIETIES REGISTRY mmmzahmm 185 mm— 0-6 [Sat rule 49] (30meor INDIA; PLANT VARIETIES REGISTRY NOTICE UNDER SECTION 28 Notice No..... ............... APPLICATION N0.‘ IN RESPECT OF Tm: 12mm VARIETIES REGISTRATION N0.... ..... Whereas ................ has/have filed an application for variation/cancellation of the terms of the registration certificate N_o............ in respect of the plant variety In view of the above, you are hereby notified to file opposition to the said application (5) with necessary documents within a period'of three months from the receipt of this notice, failing which the said application shall be disposed ofaccordingly. Dated this day of ........., 20.. ‘ SEAL AND SIGNATURE OF REGISTRAR. PLANT VARIETIES REGISTRY FORM 0-7 [See rule 51 (1)] NOTICE OF THE OFFER TO SURRENDER THE CERTIFICATE OF REGISTRATION BY THE BREEDER OF THE PLANT VARIE TY REGISTERED UNDER THIS ACT UNDER SECTION 33(2) BY THE REGISTRAR. Registrar of Plant Varietyhereby serves upon a notice to the registeredagentand_i _9_r_ regsteredhoensee ofthe application received under section 33 (1). Copy of the application along with the locompeilying statement [eeeived by the Registrar is annexed herewith. If any person notified hereby, intends to oppose the unmade! 01’ certificate ofregistration, shall within 3 months ofthe receipt of this notification my oppose in the prescribed manner. Dated this .. . .. day of ....... 200 ........ To (3) The Registered Agent At: 2 (4) The Registered Licensee At: 2 1‘ Signature ofthe Registrar ofPlant Variety or the duly Authorized person. 4. Insert the name and address of the registered agent arid/or the registered licensee 5. Stn'ke out whichever is not necessary. FORM 0—8 [See rule 53 (1)] NOTICE OF THE APPLICATION FOR REVOCATION OF THE CERTIFICATE OF REGISTRATION OF TflEPLANT VARIETY REGISTERED UNDER THIS-ACT BY ANY PERSON UNDER SECTION 34. Authority of Plant Variety hereby serves upon a notice to the registered breeder of the application received under section 34. Copy of the application along with the accompanying statement received by the Registrar is annexed herewith. If any person notified hereby, intends to oppose the revocation of celtificate ofregistration, shall within 3 months of the receipt of this notification may oppose in the prescribed manner. Dated this ........ day of ....... 20 ........ To Thengimred Breeder At? .3, simmer“; Chairman oftheAmhet'hyerthe duly Authorized person. '4. 1mm thB name game! address of the resistant! breeder md/or registered agent end/pr the mgltmed licensee: mmm [See rule 59, (1)] I . NOTICE OF THE REGISTRAR FOR3mmCANCELLATION on CHANGE OF CERTIFICATE OF REGISTRATION 0,3 mung, eerNGme on VARYINGTHE ENTRY [N THE REGISTER in the mum of Notice is hereby served by the Registrar ofPlant Variety in the evegt the Regiitrar intends to do the following Change(s) or correctiams) and in circumstances that are stated fully in the accompanying statement, 1: I cancellation the certificate of registration. I 2. changing the certificate of registration. 3: flattens, expunging or varying the entry'in the Register of Plant anety. n.- T9 . At . . 1', itpfifled Licensee 3.— ‘ Signature 9fthe Registrar of plant variety or the duly authorized persott. \ , 4: Stine the name and address. _ FORM 0-10 [Sec rule 63 (1)] NOTICE OF APPLICATION FOR CORRECTION OR REGISTER BY THE REGISTERED AGENT OR THE REGISTERED LICENSEE UNQER SECTION}? (2); . ' Registrar of Plant Variety hereby serves upon a notice to the registered hreeger ef the application received under section 37 (2‘) Copy of the application along with the accompanyigg statement received by the (“' RegistraI is annexed herewith. ‘ ‘ Dated this ........ day of ....... 200 ........ To (A) The Registered Breeder At: 2 3, Signature ofthe Registrar ofplant variety or the duly authorized person. 4. Insert the name and address. V FORM 0 — 11 (See rule 65) GOVERNMENT OF INDIA, PLANT VARIETIES REGISTRY ALTERATION IN DENOMINATION - ' Plant VafietY------------ofcrap--------having registration No............. dated--..--- Notice is hereby given that an application to alter the denomination 6f plant variety?“ made by ‘ - - ' , '- at; The altered denomination as given below has been allowed, Datedthis dsyef.u....200... SEAL AND SIGNATURE OF THE AUTHORITY PROTECTION OF PLANT VARIETIES AND FARMERS’ RIGHTS AUTHORITY FORM 0 — 12 GOVERNMENT OF INDIA, PLANT VARIETIES REGISTRY NOTICE FOR COMPENSATION TOWARDS COMMUNITIES’ RIGHTS Plant variety of crop-——--hnving Registration No.............dated— Notiee is hereby given that the claims have been received from -----------—-—-------- towards the contribution made by himlthem, in the evolution of the above plant vatiety. The breeder/his registered agetit/legal represenfitivhlassignee is directed to file any objection to such elaim(s) within three months from the date of this notice He shall substantiate his objections to the ciaims by providing, authenticated evidences. He shall be given oppoMnity ofheing heard if so desired. Dated this ............ day of .......200. .. Printed by Ilse Mange am of [Ilia pr‘a, '., Rm; Road, Msyapuri, New DeIhi-lloo ‘v w w s w x n g l m h w